Pseudomonas fulva: Psefu_0440 Help Entry Psefu_0440        CDS       T01501                                  Name (GenBank) acyl-carrier protein   KO K02078   acyl carrier protein Organism pfv  Pseudomonas fulva Pathway pfv01100   Metabolic pathways pfv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Psefu_0440    00074 Mycolic acid biosynthesis     Psefu_0440   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Psefu_0440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEF20423 UniProt:  F6AGU4 LinkDB All DBs Position complement(492467..492733) Genome browser AA seq 88 aa AA seqDB search MDHTLLEEKLKQLLIRECDKEDDIDWQSITDDEPLFGQQSRIQMDSLDALQVSLALQQHY GVRIEGAQDGRRILNSIASIAAFIRQQA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaccacacactactagaagaaaagctcaagcaattgctgattcgcgagtgcgacaag gaagacgacatcgactggcagagcatcaccgacgacgaaccgctgttcggccagcagagc cgcattcagatggacagcctcgacgccctgcaggtctccctggcgctgcagcagcactac ggggtgcgcatcgaaggcgcccaggatggccgacggattctcaacagcatcgccagtatc gcggccttcatcaggcaacaggcgtga

DBGET integrated database retrieval system