Pseudomonas fulva: Psefu_0465 Help Entry Psefu_0465        CDS       T01501                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism pfv  Pseudomonas fulva Pathway pfv01100   Metabolic pathways pfv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Psefu_0465    00074 Mycolic acid biosynthesis     Psefu_0465   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Psefu_0465 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEF20448 UniProt:  F6AHI2 LinkDB All DBs Position complement(513670..513930) Genome browser AA seq 86 aa AA seqDB search MSALQLEIKNLIIDSLGLEDVTPQDIDDDMTLFGEGLGLDSVDALELGLAIQKRFGIKID AEAKDTRTHFANVASLAAFVASRQAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgctctacagcttgagatcaaaaatctgatcatcgactccctcggtctcgaggac gtcaccccccaggacatcgatgacgacatgaccctgttcggtgaaggcctgggcctggac tcggtcgacgccctggagctcggcctggcgattcagaagcgtttcggcatcaagatcgac gccgaagccaaggacacccgcacccatttcgccaacgtggccagcctggcagccttcgtt gccagccgccaggcagcttga

DBGET integrated database retrieval system