Pseudomonas fulva: Psefu_0656
Help
Entry
Psefu_0656 CDS
T01501
Name
(GenBank) ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
pfv
Pseudomonas fulva
Pathway
pfv03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
pfv00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
Psefu_0656
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
pfv03011
]
Psefu_0656
Ribosome [BR:
pfv03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
Psefu_0656
Bacteria
Psefu_0656
Archaea
Psefu_0656
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
TGS
TM1506
Motif
Other DBs
NCBI-ProteinID:
AEF20634
UniProt:
F6AJC2
LinkDB
All DBs
Position
725729..726079
Genome browser
AA seq
116 aa
AA seq
DB search
MTDKKVTRLRRARKARLKMHELEAVRLCVYRSSQHIYAQVISADGSKVLASASTLDKALR
DGATGNVDAAKKVGELVAERAKAAGVTQVAFDRSGFKYHGRVKALADAAREGGLEF
NT seq
351 nt
NT seq
+upstream
nt +downstream
nt
atgaccgacaaaaaagttactcgtctgcgtcgcgctcgcaaagcacgcctgaaaatgcac
gagctcgaagccgtgcgtctgtgcgtgtatcgctcttcgcagcacatctacgcccaggtc
atctcggccgacggcagcaaggttctggccagcgcctctaccttggacaaagcactgcgt
gacggcgccaccggcaacgtcgacgcggccaagaaagttggtgagctggttgccgagcgc
gcgaaagccgctggtgtgacccaggttgcattcgaccgttctggcttcaagtaccacggc
cgcgtcaaggcgctggctgatgctgctcgtgaaggcgggctggagttctaa
DBGET
integrated database retrieval system