Pseudomonas fulva: Psefu_1155
Help
Entry
Psefu_1155 CDS
T01501
Name
(GenBank) response regulator receiver modulated diguanylate cyclase
KO
K11444
two-component system, chemotaxis family, response regulator WspR [EC:
2.7.7.65
]
Organism
pfv
Pseudomonas fulva
Pathway
pfv02020
Two-component system
pfv02025
Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:
pfv00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
Psefu_1155
09140 Cellular Processes
09145 Cellular community - prokaryotes
02025 Biofilm formation - Pseudomonas aeruginosa
Psefu_1155
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
pfv02022
]
Psefu_1155
Enzymes [BR:
pfv01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.65 diguanylate cyclase
Psefu_1155
Two-component system [BR:
pfv02022
]
CheA family
WspE-WspRF (chemosensory)
Psefu_1155
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
GGDEF
Response_reg
GGDEF_2
Motif
Other DBs
NCBI-ProteinID:
AEF21132
UniProt:
F6ACS6
LinkDB
All DBs
Position
1264030..1265061
Genome browser
AA seq
343 aa
AA seq
DB search
MQVPPHSMEELGSRKDGAVMVLLVDDQAMIGEAVRRELLGEEGIDFHYCSDPTQAIAVAE
QLRPTVILQDLVMPGVDGITLLGEYRARPALRDVPIIVLSTKDDATVKSSAFAAGANDYL
VKLPDTIELVARIRYHSRSYMALLQRDEAYRALRESQQQLLETNLVLQRLMNSDGLTGLS
NRRHFDEYLEMEWRRATREQTALSLLMIDVDFFKSFNDHYGHVAGDDALRRVAAALRGSC
SRSTDLAARYGGEEFAMVLPSTSAGGARLLAEKVRRAVTDLGIPHHKPEPDSVLTASIGV
ATLVPRVGQTSLQLVNLADQGLYMAKQAGRDQVGLVNDTSALS
NT seq
1032 nt
NT seq
+upstream
nt +downstream
nt
atgcaagtcccaccccattccatggaagaactcggatcacgcaaggacggcgcggtcatg
gtgttgctggtcgacgaccaggcaatgatcggggaggcggttcgtcgtgaactgctgggg
gaggagggcatcgacttccattactgctctgacccgacccaggccatcgcggtggccgag
cagctgcgaccgacggtgattctgcaggatctggtgatgcccggcgtcgacggtatcacc
ctgctcggtgagtaccgcgcgcgtccggcgctgcgcgatgtaccgatcatcgtgctgtcg
accaaggatgacgccacggtgaagagttcggcgttcgccgccggtgccaacgattacctg
gtcaagctgcccgacaccatcgaactggtggcgcgcatccgctaccactcgcgctcctac
atggccctgctgcagcgtgacgaagcctaccgcgcgctgcgcgaaagccagcagcagctg
ttggaaaccaacctggtgctgcagcggctgatgaactccgacggcctgaccgggctgtcc
aaccgccgccacttcgacgaatacctggagatggagtggcgccgcgcgactcgcgagcag
accgcgctgtcgctgctgatgatcgacgtcgacttcttcaagagcttcaacgaccactac
ggccacgtggccggcgacgatgccctgcgccgggtggccgctgcgctgcgtggcagctgc
agccgctccacggaccttgcggcgcgctacggcggcgaggagttcgccatggtgctgccc
agcacctcggccggcggcgcgcgtctgctcgcggaaaaggtacgtcgcgcggtcaccgat
ctgggcattccccaccacaagcccgagccggattcggtgctgaccgccagcatcggcgtc
gccaccctggtgccgcgggttggccagacctcgttgcagctggtcaacctggccgaccag
ggcctgtacatggccaagcaggccggccgtgatcaggtcggcctggtcaacgacaccagc
gcgctgtcctga
DBGET
integrated database retrieval system