Pseudomonas fulva: Psefu_2728 Help Entry Psefu_2728        CDS       T01501                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pfv  Pseudomonas fulva Pathway pfv01100   Metabolic pathways pfv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Psefu_2728    00074 Mycolic acid biosynthesis     Psefu_2728   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Psefu_2728 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB DUF1896 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AEF22693 UniProt:  F6AH67 LinkDB All DBs Position complement(2939174..2939410) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYVTAHAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gtgagcaccatcgaagaacgcgtcaagaaaatcgttgccgagcaactgggcgtgaaggaa gaagaagtaaccaacagcgcttccttcgttgaagacctgggtgccgactcgcttgacacc gttgagctggtgatggctctcgaagaagaattcgagaccgagatcccggacgaacaagcc gagaagatcaccactgttcaggaagccatcgactacgttactgctcacgctcagtaa

DBGET integrated database retrieval system