Pseudomonas simiae PCL1751: PF1751_v1c42120 Help Entry PF1751_v1c42120   CDS       T03766                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pfw  Pseudomonas simiae PCL1751 Pathway pfw01100   Metabolic pathways pfw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PF1751_v1c42120 (acpP)    00074 Mycolic acid biosynthesis     PF1751_v1c42120 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PF1751_v1c42120 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  AJP53907 UniProt:  A0A0C1ZYA4 LinkDB All DBs Position complement(4680877..4681113) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgtcgccgagcaactgggcgttaaagaa gaagaagtggtcaacactgcttccttcgtagaagacctgggtgccgattcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatcccggacgaagaagct gaaaaaatcactactgttcaagctgctatcgactacgttactagccaccaggcgtaa

DBGET integrated database retrieval system