Pseudomonas simiae PCL1751: PF1751_v1c52960 Help Entry PF1751_v1c52960   CDS       T03766                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism pfw  Pseudomonas simiae PCL1751 Brite KEGG Orthology (KO) [BR:pfw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pfw03036]     PF1751_v1c52960 Chromosome and associated proteins [BR:pfw03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PF1751_v1c52960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 ZapB ADIP TPR_MLP1_2 VGPC1_C Macoilin Motif Other DBs NCBI-ProteinID:  AJP54988 UniProt:  A0A293PX97 LinkDB All DBs Position 5860183..5860392 Genome browser AA seq 69 aa AA seqDB search MEDTDLQALMARLELLITRVEQLKSQNGLLLAQEKTWREERAHLIEKNEIARRKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgacctgcaagcgctgatggccagactcgaattgctaattactcgggtc gagcaacttaagagtcaaaacggactcctattagctcaggaaaagacctggcgcgaggaa cgcgctcacctcattgaaaaaaacgaaatcgcccggcgtaaggtcgaatcgatgatttcg cgcctgaaggccctggagcaagactcatga

DBGET integrated database retrieval system