Pseudomonas lurida: A7318_01360 Help Entry A7318_01360       CDS       T04730                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pfx  Pseudomonas lurida Pathway pfx01100   Metabolic pathways pfx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A7318_01360    00074 Mycolic acid biosynthesis     A7318_01360   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A7318_01360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOE77266 UniProt:  A0A5E6XA18 LinkDB All DBs Position 346465..346734 Genome browser AA seq 89 aa AA seqDB search MSDQHRLEHDIKTLIIEALGLEDIGVDDIGSEQTLFGEGLGLDSVDALELGLAIQKKYGI KIDADAKDTRNHFTNVASLAAFVTARQAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgaccaacaccgccttgagcacgacataaagacgctgatcatcgaggccctgggc ctggaagacatcggcgtagacgacatcggcagcgagcaaaccctgttcggcgaaggcctc ggcctggattcggtagacgccctggaactgggcctggcgatccagaaaaagtacggcatc aagatcgatgccgacgccaaggatacccgcaatcacttcaccaacgtggccagccttgcg gcgttcgtcacggctagacaggcagcttga

DBGET integrated database retrieval system