Pestalotiopsis fici: PFICI_12171 Help Entry PFICI_12171       CDS       T04924                                  Name (RefSeq) Cell division control protein 42   KO K04393   cell division control protein 42 Organism pfy  Pestalotiopsis fici Pathway pfy04011   MAPK signaling pathway - yeast pfy04144   Endocytosis pfy04517   IgSF CAM signaling pfy04518   Integrin signaling pfy05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pfy00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     PFICI_12171   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     PFICI_12171    04518 Integrin signaling     PFICI_12171  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     PFICI_12171  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     PFICI_12171  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pfy04131]     PFICI_12171    03036 Chromosome and associated proteins [BR:pfy03036]     PFICI_12171   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pfy04147]     PFICI_12171    04031 GTP-binding proteins [BR:pfy04031]     PFICI_12171 Membrane trafficking [BR:pfy04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     PFICI_12171  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     PFICI_12171   Macropinocytosis    Ras GTPases     PFICI_12171 Chromosome and associated proteins [BR:pfy03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     PFICI_12171 Exosome [BR:pfy04147]  Exosomal proteins   Exosomal proteins of microglial cells    PFICI_12171   Exosomal proteins of breast milk    PFICI_12171 GTP-binding proteins [BR:pfy04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     PFICI_12171 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  19277184 NCBI-ProteinID:  XP_007838943 UniProt:  W3WSK6 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MVVATIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGDEPYTLGLFDT AGQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVREKWFPEVHHHCPGVPCLIVGTQTD LRDDQSVREKLAKQKMQPVRKEDGERMAKELGAVKYVECSALTQYKLKDVFDEASLQTIF SSAETYTCR NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggtggtcgcaacgatcaaatgcgtggtcgtcggtgacggtgctgtgggcaagacgtgt ctcctgatcagctacacgacaaacaagtttccttcggaatacgttcctacagtctttgac aactatgcagtcactgttatgatcggtgacgagccatacacgttgggactctttgataca gccggtcaggaagattacgaccgacttcgacctctgtcctaccctcaaacagatgtcttc cttgtatgcttcagcgtcacttctccggcctcgttcgaaaacgtgcgggagaagtggttt ccagaagttcaccaccactgccccggcgtcccctgcctgattgttggcacgcaaaccgat ttgcgcgatgatcaaagcgtcagggagaagctggcaaagcaaaagatgcaacccgtgagg aaagaggatggtgagcggatggccaaggagctgggcgctgtcaagtacgtcgagtgcagt gctttgacgcaatataagcttaaggacgtattcgatgaggcaagtttgcaaaccatcttt tcctcggcagagacatatacatgtcgatga

DBGET integrated database retrieval system