Pseudomonas fragi: AV641_18350
Help
Entry
AV641_18350 CDS
T04285
Symbol
rnc
Name
(GenBank) ribonuclease III
KO
K03685
ribonuclease III [EC:
3.1.26.3
]
Organism
pfz
Pseudomonas fragi
Pathway
pfz03008
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:
pfz00001
]
09120 Genetic Information Processing
09122 Translation
03008 Ribosome biogenesis in eukaryotes
AV641_18350 (rnc)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03019 Messenger RNA biogenesis [BR:
pfz03019
]
AV641_18350 (rnc)
03009 Ribosome biogenesis [BR:
pfz03009
]
AV641_18350 (rnc)
03036 Chromosome and associated proteins [BR:
pfz03036
]
AV641_18350 (rnc)
Enzymes [BR:
pfz01000
]
3. Hydrolases
3.1 Acting on ester bonds
3.1.26 Endoribonucleases producing 5'-phosphomonoesters
3.1.26.3 ribonuclease III
AV641_18350 (rnc)
Messenger RNA biogenesis [BR:
pfz03019
]
Prokaryotic type
Bacterial mRNA degradation factors
RNA degradosome components
Ribonucreases
AV641_18350 (rnc)
Ribosome biogenesis [BR:
pfz03009
]
Eukaryotic type
90S particles
RNase
AV641_18350 (rnc)
Prokaryotic type
rRNA processing factors
AV641_18350 (rnc)
Chromosome and associated proteins [BR:
pfz03036
]
Eukaryotic type
Gene silencing
microRNA pathway
Microprocessor complex
AV641_18350 (rnc)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribonucleas_3_3
Ribonuclease_3
dsrm
DSRM_2
Motif
Other DBs
NCBI-ProteinID:
AMB80894
LinkDB
All DBs
Position
complement(4086505..4087194)
Genome browser
AA seq
229 aa
AA seq
DB search
MSFSLERLERQLGYTFKDQELMILALTHRSFAGRNNERLEFLGDAILNFVAGEALFDRFP
LAREGQLSRLRARLVKGETLAVLARGFELGEYLRLGSGELKSGGFRRESILADALEALIG
AIYLDAGMDAARDRVLAWLASEFETLTLVDTNKDPKTRLQEFLQSRACDLPRYEVVDIQG
EPHCRTFFVECEIALLNEKSRGQGVSRRIAEQVAAAAALIALGVENGHD
NT seq
690 nt
NT seq
+upstream
nt +downstream
nt
gtgagtttttctttagagcgtttagagcgtcagctcggctataccttcaaagaccaggag
ctgatgattctggccctgacacaccgcagtttcgcggggcgcaataacgagcgtctcgag
tttctgggggatgccattcttaattttgtagccggcgaagcgctgtttgaccgctttccg
ctggcccgggaaggccagctgtcgcgcttgcgtgcccgcctggtaaaaggtgaaaccctg
gccgtcctggcccgtggttttgaactgggcgagtatctgcgcctgggctcgggtgagctc
aagagcggtggttttcgccgtgagtcgattctggccgatgccctcgaagcgctgattggc
gccatttacctggatgcgggcatggatgccgcccgtgaccgcgtactggcctggcttgcc
agcgagttcgagaccctgaccctggtcgacaccaacaaagatccaaagacccgcctgcaa
gagttcttgcagtcacgtgcctgtgatctgccacgttacgaagtggtagatatccagggc
gaaccgcattgccgcacattcttcgttgagtgcgaaattgccctattgaatgaaaaaagc
cggggtcagggtgtgagccgtcgtattgccgaacaggtagcggccgccgcagcactgata
gcccttggcgtggagaatggccatgactga
DBGET
integrated database retrieval system