Phaeobacter inhibens DSM 17395: PGA1_c00780
Help
Entry
PGA1_c00780 CDS
T02192
Symbol
sMC
Name
(GenBank) putative chromosome segregation protein SMC
KO
K03529
chromosome segregation protein
Organism
pga
Phaeobacter inhibens DSM 17395
Brite
KEGG Orthology (KO) [BR:
pga00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03036 Chromosome and associated proteins [BR:
pga03036
]
PGA1_c00780 (sMC)
Chromosome and associated proteins [BR:
pga03036
]
Prokaryotic type
Chromosome partitioning proteins
Condensin-like complex
PGA1_c00780 (sMC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SMC_N
AAA_23
AAA_21
AAA_15
ABC_tran
SMC_hinge
AAA_29
Motif
Other DBs
NCBI-ProteinID:
AFO89824
LinkDB
All DBs
Position
75090..78545
Genome browser
AA seq
1151 aa
AA seq
DB search
MRFSKLRLNGFKSFVDPTDLLIADGLTGVVGPNGCGKSNLLEALRWVMGENRPKAMRGGG
MEDVIFAGTSSRPARNFAEVSLQIDNSERLAPSGFNESDNLEILRRITRDVGSAYKTNGK
DVRARDVQMLFADASTGAHSPALVRQGQIAELINAKPKARRRILEEAAGISGLYQRRHEA
ELKLKNTEQNLLRVDDVIEQLAAQLSQLARQARHAQRYRDIGEQLRRAEGMLLYRRWREA
DDARLEAEDILRTRETQAAKAEALARVADGKRLEAESALPPLREEEAIAAAVLQRLFVQR
DALSDQEAQARQTIETLTNRVAQLGRDIERESGLNRDAGETIERLDWEQRELARAAIGHD
DRMAEAAERSREAGSVLQAREEHLTSLTEDVARLAARHQSAQRQVEDCRRGLLRAEEEGG
ASRDAMVEAGDTLAQAEAAFEAAIEAEEEARAAAELADEALAAADEARNDTQSREAEARA
RRSEAEGELGALRAEVTALAKLVERDTAEGGHVLDEMRVAAGYEKALGAALADDLRAPLA
EVDGPSGWVTLPPYDGDAPLPAGAVPLSLHVSSPDALHRRISQVGLVDADAARDLHSRLM
PGQRLVTLEGDLWRWDGFRAWAEDAPSAAALRLEQMNRLEVLKQDMEHVGARADGAKAAH
EVLMRKLAEVTTADQTARQARRVADQRVADAARALSRAESHRNLSEGKLETLSIAVARHD
EDAAAAQAHLTEAEAAVEGLEDLAEARAKVEDIKQAVEAARITMLTHRSTQDELRREGEA
RTARGQQVTKDLSGWRHRLESADRRIAELTERRAATEEELQEAHQVPAEIAETHEELNLA
IEEAEARKAVASDALIGAETVLRDAVQNERECARLASEAREARARSEARCDAAREAVGHA
EARIREEQQTVPDALLASLDATPEDMPNAEELEAEVNRHKRQRDALGAVNLRAEEDARTV
QDEHDQLVREKADLEEAVKTLRSGIASLNREGRERLLTAFEEVNASFTMLFTHLFGGGEA
NLVMVESDDPLDAGLEIMCQPPGKKLSTLSLLSGGEQTLTAMALIFAVFLSNPAPICVLD
EVDAPLDDANVTRFCDLLDEMCRQTDTRFLIITHHAVTMARMDRLFGVTMQEKGVSQLVS
VDLKKAEALVA
NT seq
3456 nt
NT seq
+upstream
nt +downstream
nt
ttgcgcttctcgaaactcagactgaacggcttcaagagctttgtggacccaacggatctg
ctgatcgcggatggcctgacaggggttgtgggcccaaatggctgtggcaagtccaacctt
cttgaggcgctgcgctgggtgatgggcgaaaatcgcccaaaggcgatgcgtggcggcggc
atggaggacgtgatcttcgctggcaccagctccaggccagcccgtaattttgccgaggtc
agcctgcagatcgacaatagtgagcggctggccccatctggcttcaacgagagcgacaat
cttgaaatcctgcgccgtatcacccgcgatgtcggcagcgcctacaaaaccaacggtaag
gatgtgcgcgcgcgcgatgtacagatgctgtttgccgatgcctcaactggtgcgcattct
ccagctttggttcggcaggggcaaattgccgagttgattaatgccaagccgaaagcacgg
cggcgtattctggaagaggcggcaggtatctctggcctttaccagcggcggcacgaggcc
gagctgaagctgaagaacaccgaacagaacctgttgcgcgtcgatgatgtgattgaacag
ctcgcggcacaactctcgcagctggcccgtcaggcacgccatgcacagcggtatcgcgat
atcggtgaacagctgcgtcgggccgagggcatgttgctctaccgtcgatggcgggaggcg
gatgacgcgcggctggaagctgaagatatccttcgaacccgcgagacacaggcggccaaa
gcagaggcgttggcccgtgttgccgatggcaagcggctggaggctgagagtgcgctgccg
cccctgcgcgaggaagaggcaattgccgccgccgtcctgcaacgactgtttgtccagcgc
gacgcgttgagtgatcaggaggcgcaggcgcgccagaccatcgaaacgctgaccaaccgc
gtggcacagttgggccgcgacattgagcgcgaaagcgggctgaaccgagatgccggcgaa
acgattgaacggctggactgggaacagcgtgagttggcgcgggctgctatcggtcacgat
gatcgcatggctgaggccgcagagcgttcgcgagaagcgggatcggtgcttcaggcccgc
gaggaacatctgacgagcctgacagaagatgtcgcgcggcttgcggcacgtcatcaatca
gcgcagcgtcaggtcgaagattgccgccgtggtttgctccgtgccgaggaggaagggggg
gcttcccgcgacgcgatggtcgaggctggcgatacgttggcccaggcagaggcagcgttt
gaggcggcgattgaggctgaagaggaagcgcgcgccgcggctgaactcgccgatgaggcg
ctcgccgcggcagatgaagcgcgcaacgatacccaatcgcgtgaggccgaggcccgtgcg
cgccgttccgaagcggagggcgaattgggtgcactgcgggcggaggtgacagcgcttgcg
aagctcgtggaacgcgataccgccgagggtggccatgttctggacgagatgcgcgtcgca
gcgggatatgagaaggcgcttggtgctgctcttgccgatgacctgcgcgcccctctggcg
gaggttgatggccctagcggttgggtcaccttgccgccatatgacggcgatgcgccgctg
ccagcgggtgcggtaccgctctccctgcatgtcagtagccccgatgcgctgcatcgtcgg
atttctcaggttggtctcgtcgatgctgatgccgcgcgtgacctgcattcgcggttgatg
cctgggcagcgtctggtcacccttgaaggggatttgtggcgctgggatgggttccgggcc
tgggctgaggatgcgccaagcgcggctgcgttgcggctggagcaaatgaaccgccttgaa
gtgctgaaacaggacatggagcacgtgggcgcgcgtgcagatggagctaaggctgcgcat
gaagttcttatgcgcaagctggcagaggttaccaccgcagatcagaccgcgcgtcaggcg
cgccgggttgctgatcaacgcgttgcggatgcggcgcgcgcgctgagccgggctgaaagt
catcgcaatctgtccgaaggcaagctggaaaccctcagcatcgcggttgcccggcacgat
gaggatgctgccgctgcgcaggcacatctgacggaagcggaagccgctgtcgaaggattg
gaggatctcgctgaggcgcgtgccaaggtcgaggatataaaacaggcggtggaagctgca
cggatcacgatgctgacccatcggtcgacccaggatgagctgcggcgcgaaggagaggcc
cgcactgcgcgtgggcagcaggtcaccaaggatctctcggggtggcgtcaccggctggag
agtgcggacaggcggatcgctgagctgacggagcgccgtgccgcgaccgaggaagagctg
caagaggcacatcaggtccctgccgaaattgcggagacccacgaggaactaaaccttgcc
attgaagaagctgaagcgcgtaaggcagttgcctccgatgcgctgattggtgctgaaact
gttctgcgcgacgccgttcaaaacgaacgtgaatgcgcgcgactggcctctgaagcgcgt
gaagcacgggcccggtctgaggcgcgttgcgacgcagcccgcgaagccgtaggtcatgcc
gaagcgcgtattcgcgaagaacaacagacagtgcctgacgctctgttggccagccttgat
gcgacgcctgaagacatgccgaacgcggaggaactggaagcagaggtcaaccgtcacaag
cgccagcgcgacgcgctgggagcggtcaacctgcgcgcagaagaagacgcgcgcacggtt
caggatgagcatgatcaattggtgcgcgagaaggctgatctggaagaagccgtcaagacg
ctgcggtcgggcatcgccagcctcaaccgcgagggtcgcgaacggttgctgaccgcgttt
gaggaggtgaatgcgagctttaccatgctgttcactcatctcttcggcggcggggaggcc
aatcttgtcatggtcgaaagtgatgatccgttggatgccgggcttgagatcatgtgtcag
ccgccgggcaagaaactctcgacgttgtcactgctgtctgggggcgaacagacattgacc
gcaatggccctgatctttgcggtgtttctgtcgaacccggccccgatctgtgtgctggat
gaggtggatgcgccgctggatgatgccaatgtcacccgtttctgcgatttgctggacgag
atgtgccgccagaccgacacgcgctttctgattatcacgcaccacgcggtgacgatggcg
aggatggatcggctgttcggggttaccatgcaggaaaaaggcgtcagtcaactggtgtct
gtggatctcaagaaagctgaggcgttggtcgcctga
DBGET
integrated database retrieval system