Phaeobacter inhibens DSM 17395: PGA1_c10730 Help Entry PGA1_c10730       CDS       T02192                                  Symbol rpiB Name (GenBank) ribose-5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism pga  Phaeobacter inhibens DSM 17395 Pathway pga00030   Pentose phosphate pathway pga00051   Fructose and mannose metabolism pga00710   Carbon fixation by Calvin cycle pga01100   Metabolic pathways pga01110   Biosynthesis of secondary metabolites pga01120   Microbial metabolism in diverse environments pga01200   Carbon metabolism pga01230   Biosynthesis of amino acids Module pga_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:pga00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     PGA1_c10730 (rpiB)    00051 Fructose and mannose metabolism     PGA1_c10730 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     PGA1_c10730 (rpiB) Enzymes [BR:pga01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      PGA1_c10730 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  AFO90792 LinkDB All DBs Position 1109503..1109958 Genome browser AA seq 151 aa AA seqDB search MDQKKPTRVVLSSDHAAIELRQAIADHITANGWEVVDIGPTTPESTHYPKHGAAAAERVA SGDCDLGIILCGTGQGIMMAANKVKGIRCGVCSDTFSAKMIRQHNNANMLSIGARVVGDS LAIEIVDAFLNAEFEGGRHATRVDMIEPQDS NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atggaccagaaaaaaccaacccgcgttgtgctttccagcgaccacgccgcgattgagctg cgtcaggctatcgcggaccatatcaccgcaaacggctgggaggtcgtcgatattggcccc accaccccggagagcacccattaccccaagcacggcgcagccgcggcggagcgtgtggcc tcgggcgattgcgacctcgggatcattctttgcggaaccggccagggcatcatgatggcc gcaaacaaggtgaagggcatccgttgcggggtctgctccgataccttctccgccaagatg atccgccagcacaacaacgccaatatgctctccatcggggcgcgtgtggttggtgacagc ctcgcgattgagatcgttgatgccttcctcaatgctgagttcgaaggcggtcgccacgcc acccgcgtggatatgattgagccgcaggacagctga

DBGET integrated database retrieval system