Phaeobacter inhibens DSM 17395: PGA1_c17920 Help Entry PGA1_c17920       CDS       T02192                                  Symbol acpP Name (GenBank) acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism pga  Phaeobacter inhibens DSM 17395 Pathway pga01100   Metabolic pathways pga01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pga00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PGA1_c17920 (acpP)    00074 Mycolic acid biosynthesis     PGA1_c17920 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PGA1_c17920 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AFO91492 LinkDB All DBs Position complement(1873146..1873379) Genome browser AA seq 77 aa AA seqDB search MSDVADRVKKIVVEHLGVEEDKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISEAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtcgcagaccgcgtaaaaaagatcgttgtggaacacctgggtgttgaagaa gacaaagtgaccgagaacgcgtcgttcatcgatgatctgggcgcagacagcctggacacc gttgagctggttatggctttcgaagaagagttcggcatcgaaatccccgatgatgcagcc gagaccatccagacctttggcgatgcggtgaagttcatcagcgaagcttcctga

DBGET integrated database retrieval system