KEGG   Phaeobacter inhibens DSM 17395: PGA1_c34000
Entry
PGA1_c34000       CDS       T02192                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00190  Oxidative phosphorylation
pga01100  Metabolic pathways
pga02020  Two-component system
pga04148  Efferocytosis
Module
pga_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:pga00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PGA1_c34000 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PGA1_c34000 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    PGA1_c34000 (petA)
Enzymes [BR:pga01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     PGA1_c34000 (petA)
SSDB
Motif
Pfam: UCR_Fe-S_N Rieske UCR_TM
Other DBs
NCBI-ProteinID: AFO93036
LinkDB
Position
complement(3564175..3564735)
AA seq 186 aa
MSHAEDNEGTRRDFLYYATAGAGAVTAGAAIWPLVNQMNPSADVQALSSIIVDVSGVEVG
TQLSVMFLGKPVFIRRRTEEEIEEARAVDLAELPDQQDRNANKPGLDASDENRTLDDAGE
WLVMMGVCTHLGCVPLGDGAGDFNGWFCPCHGSHYDTAGRIRKGPAPENLPVPAAEFIDE
TTIQLG
NT seq 561 nt   +upstreamnt  +downstreamnt
gtgtcccacgcagaagacaacgaaggaacccggagagatttcctctactacgccactgcc
ggcgccggggcagtgactgcgggtgccgcaatttggcccctggtcaaccagatgaacccc
tcggctgacgttcaggctctgtcctcgatcatcgtggatgtgagcggcgtggaagtcggg
actcagctctcggttatgttccttggcaagccggtgttcattcgccgccgtaccgaggaa
gaaatcgaagaagcccgtgctgtcgatctggcggaactgcctgatcagcaggaccgcaat
gcgaacaaacctggtctggacgcatccgacgaaaaccgcaccctggatgacgctggcgaa
tggctggtgatgatgggtgtgtgtacccacctcggttgcgtgccgttgggtgacggtgca
ggcgatttcaacggctggttctgcccctgccatggttcgcattacgacactgccggtcgt
atccgcaaaggccccgcacccgagaacctgccggttccggccgcggagttcatcgacgaa
accaccatccaactgggataa

DBGET integrated database retrieval system