Phaeobacter inhibens DSM 17395: PGA1_c34000
Help
Entry
PGA1_c34000 CDS
T02192
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
KO
K00411
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:
7.1.1.8
]
Organism
pga
Phaeobacter inhibens DSM 17395
Pathway
pga00190
Oxidative phosphorylation
pga01100
Metabolic pathways
pga02020
Two-component system
pga04148
Efferocytosis
Module
pga_M00151
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:
pga00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
PGA1_c34000 (petA)
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
PGA1_c34000 (petA)
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
PGA1_c34000 (petA)
Enzymes [BR:
pga01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.8 quinol---cytochrome-c reductase
PGA1_c34000 (petA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UCR_Fe-S_N
Rieske
UCR_TM
Motif
Other DBs
NCBI-ProteinID:
AFO93036
LinkDB
All DBs
Position
complement(3564175..3564735)
Genome browser
AA seq
186 aa
AA seq
DB search
MSHAEDNEGTRRDFLYYATAGAGAVTAGAAIWPLVNQMNPSADVQALSSIIVDVSGVEVG
TQLSVMFLGKPVFIRRRTEEEIEEARAVDLAELPDQQDRNANKPGLDASDENRTLDDAGE
WLVMMGVCTHLGCVPLGDGAGDFNGWFCPCHGSHYDTAGRIRKGPAPENLPVPAAEFIDE
TTIQLG
NT seq
561 nt
NT seq
+upstream
nt +downstream
nt
gtgtcccacgcagaagacaacgaaggaacccggagagatttcctctactacgccactgcc
ggcgccggggcagtgactgcgggtgccgcaatttggcccctggtcaaccagatgaacccc
tcggctgacgttcaggctctgtcctcgatcatcgtggatgtgagcggcgtggaagtcggg
actcagctctcggttatgttccttggcaagccggtgttcattcgccgccgtaccgaggaa
gaaatcgaagaagcccgtgctgtcgatctggcggaactgcctgatcagcaggaccgcaat
gcgaacaaacctggtctggacgcatccgacgaaaaccgcaccctggatgacgctggcgaa
tggctggtgatgatgggtgtgtgtacccacctcggttgcgtgccgttgggtgacggtgca
ggcgatttcaacggctggttctgcccctgccatggttcgcattacgacactgccggtcgt
atccgcaaaggccccgcacccgagaacctgccggttccggccgcggagttcatcgacgaa
accaccatccaactgggataa
DBGET
integrated database retrieval system