Plasmodium gaboni: PGSY75_0721800 Help Entry PGSY75_0721800    CDS       T08136                                  Name (RefSeq) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism pgab  Plasmodium gaboni Pathway pgab03050   Proteasome pgab03440   Homologous recombination Brite KEGG Orthology (KO) [BR:pgab00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     PGSY75_0721800   09124 Replication and repair    03440 Homologous recombination     PGSY75_0721800  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pgab03019]     PGSY75_0721800    04131 Membrane trafficking [BR:pgab04131]     PGSY75_0721800    03051 Proteasome [BR:pgab03051]     PGSY75_0721800    03400 DNA repair and recombination proteins [BR:pgab03400]     PGSY75_0721800 Messenger RNA biogenesis [BR:pgab03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      PGSY75_0721800 Membrane trafficking [BR:pgab04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     PGSY75_0721800 Proteasome [BR:pgab03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      PGSY75_0721800 DNA repair and recombination proteins [BR:pgab03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      PGSY75_0721800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YqiJ_OB Motif Other DBs NCBI-GeneID:  29775675 NCBI-ProteinID:  XP_018642560 UniProt:  A0A151LQC7 LinkDB All DBs Position 7:705730..706309 Genome browser AA seq 106 aa AA seqDB search MQKNMQDNSNKNEFSDMKENKNEGKVNEISGENMYIFDEPDDELEEFEEMGSVALNVDTD LENWEEDWGAAGWDDDDDDDDKFILKVESELQKFKANMEAEKDLNK NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgcaaaaaaatatgcaggataacagtaataaaaatgaatttagtgatatgaaagaaaat aagaatgagggaaaagtaaatgaaatcagtggagaaaatatgtatatttttgatgagcct gatgatgaattggaagaatttgaagaaatgggaagtgtagctttaaatgtagacacagac ttggaaaactgggaagaagattggggagcagcaggatgggatgatgatgatgacgatgac gataaatttattttaaaagttgaatcggaattacaaaaatttaaagctaatatggaagca gaaaaggatttaaataaataa

DBGET integrated database retrieval system