KEGG   Pseudomyrmex gracilis (graceful twig ant): 109855237
Entry
109855237         CDS       T05003                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
pgc  Pseudomyrmex gracilis (graceful twig ant)
Pathway
pgc00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    109855237
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pgc00199]
    109855237
Enzymes [BR:pgc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     109855237
Cytochrome P450 [BR:pgc00199]
 Cytochrome P450, animal type
  CYP306 family
   109855237
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 109855237
NCBI-ProteinID: XP_020284839
LinkDB
Position
Unknown
AA seq 489 aa
MIFLTYIIFSIILILLIYIFRKNRKTLRLPPGPTGIPLLGYLPWLDPKRPHESLTNLAKQ
YGPICGLKMGSIYTVLLSDPQLVRQAFAKDAFAGRAPLYLTHGIMQGYGLISAEGDLWRD
QRRFVTGCLKNFGMVKLPGAKRDKMEKRILAIVDECISKLKERATEDIDPLDTMHHCIGN
IINNLVFGKMYDENDEVWKWLRHLQEEGVKHIGVAGPLNFFPFLRFIPRYGKLMESLIGG
KIKTHKIYQMIIDEHRARPEKTDTFLAAFDNVMSTNANNSGSFTQLQFYHLLADLFGAGT
DTTLTTFRWFLLFMAVYPDEQKKIKDEMYEVLGQKLPCLEDRLVLIQLEAAIAETQRIRS
ITPLGVPHGTVEDTQIGDYDIPKGAMIIHLHWSIHLDPSYWHDPLAFKPERFISENGSLA
KPKAFMPFQTGKRVCVGDELAKMILFLLAARILYSFDISVPPNTQIDLEGECGITLIPKS
YRLVFTPRK
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgatattccttacttatatcatcttcagcattatccttatacttcttatttacattttt
cgtaaaaatcgcaaaacgctccgacttcccccgggaccgaccggcatcccattgctcggt
tatttaccatggttagatcccaaacggccacacgaatcactgacaaatctggcgaagcaa
tacggtccgatttgtggccttaaaatggggtccatttataccgttttattatcagaccct
cagctggtaaggcaggcttttgccaaggatgcatttgccggcagggctccactctattta
acgcatggcataatgcagggatatggccttattagcgccgagggtgacctctggagagat
caaagaaggtttgtaactggatgcttgaagaatttcggcatggtaaagttacctggtgcc
aaaagggacaagatggagaagagaattctcgcgatcgtggacgagtgcatatcgaaatta
aaggaacgtgctacagaggatatcgatccattggatacgatgcatcattgcataggtaat
ataataaataacctcgtgtttggcaagatgtacgatgaaaatgacgaggtgtggaaatgg
ctgagacacttgcaagaagaaggagttaagcacattggagtagcagggccgctcaatttt
tttccatttctcagatttataccacgatatggcaaattaatggagtcgcttatcggtggt
aaaataaaaacgcataaaatatatcaaatgataatcgacgaacatcgtgctcgacctgag
aaaacagatacctttcttgcagcttttgacaatgtaatgagtactaacgctaacaattct
ggatctttcacacaattacaattttatcacttgttagccgatcttttcggcgcaggtacc
gatactactctgacgacatttcgttggtttctgctttttatggcggtatatccagacgaa
caaaaaaaaattaaagatgaaatgtatgaagtattgggacaaaagttaccttgcttagaa
gacagacttgttttaattcaactggaagcagccattgcggagacacaaagaatacgaagc
atcacaccgcttggcgttccgcatggtacagtagaggatacgcaaataggtgattacgat
ataccgaaaggtgccatgattattcatttgcattggtctattcatctggatccttcttat
tggcacgatccgctcgctttcaagcccgaaagatttatcagcgagaatggaagtctcgcc
aagccaaaagctttcatgcctttccagacgggtaaacgcgtgtgcgttggcgatgaactg
gcaaaaatgatattattcttgcttgctgcaagaatactttattcatttgatatttctgta
cctcctaatacgcaaatcgatctggaaggcgaatgcggaattaccctgattccgaagtcg
tatcgattggttttcacaccgcggaaataa

DBGET integrated database retrieval system