Pluralibacter gergoviae: LG71_02585
Help
Entry
LG71_02585 CDS
T03300
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
pge
Pluralibacter gergoviae
Pathway
pge03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
pge00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
LG71_02585
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
pge03011
]
LG71_02585
Ribosome [BR:
pge03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
LG71_02585
Bacteria
LG71_02585
Archaea
LG71_02585
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Ribosomal_L5e
Motif
Other DBs
NCBI-ProteinID:
AIQ98852
UniProt:
A0A089PGG1
LinkDB
All DBs
Position
complement(553346..553699)
Genome browser
AA seq
117 aa
AA seq
DB search
MDKKSARIRRATRARRKLKELGATRLVVHRTPRHIYAQVIAPNGSEVLVAASTVEKAISE
QLKYTGNKDAAAAVGKAVAERALEKGIKDVSFDRSGFQYHGRVQALADAAREAGLQF
NT seq
354 nt
NT seq
+upstream
nt +downstream
nt
atggataagaaatctgctcgtatccgtcgtgcgacccgcgcacgccgcaagctcaaagag
ctgggtgcaactcgcctggtggtacatcgtaccccgcgtcacatttacgcacaggtaatt
gcaccgaacggttctgaagttctggtagctgcttctactgtagaaaaagctatctctgaa
caactgaagtacaccggtaacaaagacgctgctgcagctgtgggtaaagctgtcgctgaa
cgcgctctggaaaaaggcatcaaagatgtgtcctttgaccgttccgggttccaatatcat
ggtcgtgtccaggcactggcagatgctgcccgtgaagctggccttcagttctaa
DBGET
integrated database retrieval system