Pluralibacter gergoviae: LG71_03160 Help Entry LG71_03160        CDS       T03300                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pge  Pluralibacter gergoviae Pathway pge01100   Metabolic pathways pge01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pge00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LG71_03160    00074 Mycolic acid biosynthesis     LG71_03160   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LG71_03160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIQ98963 UniProt:  A0A089PLC0 LinkDB All DBs Position 662842..663102 Genome browser AA seq 86 aa AA seqDB search MLNREIVMDYILECLQGMVTNGVEIEPDSDLVNELGLESIKVMDLLMMLEDRFDISIPIN ILLDVRTPAQLLAALLPHLEKTYGPL NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgctaaatcgtgaaatagtgatggactatatccttgaatgtttacagggtatggttaca aatggggtggaaatcgagccggacagcgacctcgttaatgaactcggtcttgagtctatc aaagtgatggacctgctgatgatgttagaagatcgctttgatatttccattccaatcaat attttactggatgtaagaacgccggcgcagctgctggcagccttgcttccccacctggag aaaacctatgggcctttatga

DBGET integrated database retrieval system