Pluralibacter gergoviae: LG71_18920 Help Entry LG71_18920        CDS       T03300                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pge  Pluralibacter gergoviae Pathway pge01100   Metabolic pathways pge01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pge00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LG71_18920    00074 Mycolic acid biosynthesis     LG71_18920   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LG71_18920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AIR01843 UniProt:  A0A089PPK2 LinkDB All DBs Position complement(4018650..4018886) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaggacctgggcgctgattctcttgacact gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system