Pseudomonas germanica: J0G10_01095
Help
Entry
J0G10_01095 CDS
T08191
Name
(GenBank) SulP family inorganic anion transporter
KO
K03321
sulfate permease, SulP family
Organism
pgf
Pseudomonas germanica
Brite
KEGG Orthology (KO) [BR:
pgf00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
pgf02000
]
J0G10_01095
Transporters [BR:
pgf02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
J0G10_01095
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Sulfate_transp
STAS
STAS_2
SAM_GIDA_C
Motif
Other DBs
NCBI-ProteinID:
QYY82081
UniProt:
A0ABX8YSF7
LinkDB
All DBs
Position
complement(243234..244802)
Genome browser
AA seq
522 aa
AA seq
DB search
MAFPSRHSLFPFLTWLPRQTRASVGRDLIVGLSGAILALPQSIAYALIAGLPPEYGLYAA
IIPVLIACLWGSSWHLICGPTAAISIVLFASVSPLAVPASQDYITLILLLTLLAGIFQWL
LGLLRFGALVNFVSHSVVLGFTLGAAVVIAIGQLPNLLGLELPAKATALASLMDLLQHLR
AVDKPSLVLGLTTVVVGLLLKHLLPRWPTLLITLVLASLLVWLWPGVFGHVHLVSAFVGR
LPPFSGLPLDLDLILRLLPSAVAVGMLGLVTSLSIARSISTRSQQLLDANQEVRAQGLSN
ILGAFFSGSLSAGSFTRSGLSYEAGACSPLAGVFSAIWVALFAIFGAGLIAHIPIPAMAG
SILLIAWGLVDHRGIRSLLRVSRAEFVVMALTCLATLLLELQTAIYAGVLASLFFYLKRT
SQPRVQHWRDGEDDVLRVGGSIFFGASHYLQVRLQRMHGARVVIEAQQINFIDYSGVEML
HQEARRLLSQNRSLTLRRARPQVVEELRKLEGPEKCPIRFED
NT seq
1569 nt
NT seq
+upstream
nt +downstream
nt
atggccttccccagccgccactctctcttccccttcctcacctggttgccgcgacaaacc
cgcgccagcgtcggacgggatctgatcgtcggcctcagcggggcgattctcgccttaccc
cagtcgattgcctacgcattgatcgccggtctgccacctgagtacggcctctacgccgcg
atcatcccagtgctgatcgcctgcctgtggggttcgtcgtggcatttgatctgcggtccg
acggcagcgatttcgattgtgctgtttgccagtgtcagccctttagcggttccggcctcg
caggactacatcaccctgatcctgctgctgaccttgcttgcggggatattccagtggctg
ctcggtttgctgcgctttggcgcgctggtgaatttcgtctcgcattcggtggtgctgggg
ttcacccttggcgcggcggtggtgattgctatcgggcaattgccaaacctgctgggcctg
gagttgccggcaaaagccacggcgctggccagtttgatggatctgctgcaacacctgagg
gctgtggataaaccttcgctggtgttgggtttgaccacggtggtcgtcggtctgctgctc
aaacacctgttgccgcgctggccgacgctgttgatcacgctggtgctggccagtttgctg
gtgtggttgtggccgggcgtgttcggccatgtgcatctggtcagcgcgtttgtcgggcgt
ttgccgccgttcagtggattgccgctggatctggatttgatcctgcggttgctgccaagc
gctgtggcggtgggcatgctcggcctggttaccagtctgtcgattgcccgctcgatttcg
acgcggtcgcagcaattgcttgatgccaatcaggaagtccgtgcgcagggcttgtcgaat
attctcggggcgttcttttccgggtcgctgtcggccgggtcgttcacccgctcgggccta
agttacgaggcgggcgcttgctcgccgctggccggggtgttttcagcaatctgggtggcg
ttgttcgcaatttttggtgcggggctgattgcgcacattccgatcccggcgatggctggg
agcattctgttgattgcctgggggctggtcgaccaccgaggcattcgctcattgctgcgc
gtcagccgcgccgagttcgtggtgatggcgctgacctgcctcgcgactttgctgctggaa
ttgcagacggcgatttatgccggtgtgctggcctcgctgttcttctacctcaagcgcact
tcgcaaccgcgcgtgcagcactggcgcgacggcgaagacgatgtgttgcgtgtcggcgga
tcgatctttttcggcgccagccattacctgcaagtacgtctgcagcgcatgcacggcgca
cgcgtggtgattgaggcgcagcagatcaacttcatcgactattcgggcgtggagatgttg
catcaggaggcgcgacgcttgcttagccagaatcgcagcctgaccttgcgccgggcgcgg
ccgcaggtcgtagaggagttacgcaaactggaagggccagagaaatgcccgatccggttt
gaggattga
DBGET
integrated database retrieval system