Pseudomonas germanica: J0G10_03255 Help Entry J0G10_03255       CDS       T08191                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pgf  Pseudomonas germanica Pathway pgf01100   Metabolic pathways pgf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pgf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J0G10_03255    00074 Mycolic acid biosynthesis     J0G10_03255   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J0G10_03255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QYY82487 LinkDB All DBs Position complement(739920..740195) Genome browser AA seq 91 aa AA seqDB search MSDLNTPSLVRDIKLLIIDALGLEDISVDDIEDEQTLFGEGLGLDSVDALELGLAIQKKY GIKIDADAKDTRNHFTNVASLAAFVTAKQAA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctgaacacccctagcctggtgcgtgacatcaaactgctgatcatcgacgcc ctcggcctcgaagacatcagcgtcgacgacatcgaagacgagcaaacactgttcggcgaa ggcctgggcctggattccgtcgacgcgctggaactgggtctggccatccagaaaaaatac ggcatcaagatcgatgccgacgccaaagacacccgtaaccatttcaccaacgtggccagc cttgcggcgttcgtcacggcaaaacaggcagcttga

DBGET integrated database retrieval system