Pseudomonas graminis: FX982_01705 Help Entry FX982_01705       CDS       T06934                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism pgg  Pseudomonas graminis Brite KEGG Orthology (KO) [BR:pgg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pgg03036]     FX982_01705 Chromosome and associated proteins [BR:pgg03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     FX982_01705 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 ZapB Filament Macoilin ADIP TPR_MLP1_2 VGPC1_C Matrilin_ccoil SOGA1-2-like_CC Motif Other DBs NCBI-ProteinID:  QKF50761 UniProt:  A0A1C2EBK2 LinkDB All DBs Position complement(1862815..1863024) Genome browser AA seq 69 aa AA seqDB search MEDNDLQALMARLELLINRVEQLKSQNGLLLAQEKSWREERAQLIEKNEIARQKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaatgacctgcaagcgctgatggctcgactggagttattgatcaatcgtgtc gagcaactaaaaagtcaaaacggactcctattagctcaggaaaaatcctggcgcgaggaa cgcgctcaactcattgaaaaaaacgaaatcgcccggcaaaaggtcgagtccatgatttcg cgcctcaaggccctggagcaagactcatga

DBGET integrated database retrieval system