KEGG   Pseudomonas graminis: FX982_01803
Entry
FX982_01803       CDS       T06934                                 
Name
(GenBank) Alpha-ketoglutarate-dependent taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
pgg  Pseudomonas graminis
Pathway
pgg00430  Taurine and hypotaurine metabolism
pgg00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:pgg00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    FX982_01803
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    FX982_01803
Enzymes [BR:pgg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     FX982_01803
SSDB
Motif
Pfam: TauD NUFIP1
Other DBs
NCBI-ProteinID: QKF50857
UniProt: A0A6M8MUF7
LinkDB
Position
complement(1963658..1964491)
AA seq 277 aa
MSIDIHPLSPALGAQISGVDLSLDLTGEQRNVIERALLDHQVLFFRDQPITPQQQARFAA
HFGDLHIHPIYPNVPEQPEVLILDTAVTDVRDNAIWHTDVTFLPTPALGAVLSAKQVPAY
GGDTLWASGIAAFEALSRPMQMLLDGLTATHDFTRSFPLERFGNTAEDLARWEETRRKNP
PLSHPVIRTHPVSGRKALFVNEGFTTRINELEAAESEAILKLLFAHGTRPEFTLRWRWQA
NDVAMWDNRVTQHYAVDDYRPQRRVMHRATILGDAPF
NT seq 834 nt   +upstreamnt  +downstreamnt
atgagcatcgacatccacccgctcagcccggcattgggcgcacagatcagcggcgttgac
ctcagcctcgacctgaccggtgagcaacgcaacgtcattgaacgggcgctgcttgatcat
caggtgctgtttttccgggatcagccgatcacgccgcagcaacaggcgcgattcgccgcc
cattttggtgacctgcacattcacccgatataccccaacgtgccggaacagcctgaagtg
ctgatcctcgatacggcggtcaccgacgtgcgcgacaacgccatctggcacaccgatgtc
acctttctgccgacccctgcgctgggtgcggtgcttagcgccaagcaggtgccggcttac
ggtggggatacgttgtgggcgagcggcatcgctgcgttcgaggcgctgtcccggccgatg
cagatgttgctcgatggcctcaccgcgacccatgacttcacccggtcattcccgctggag
cgctttggcaatacggctgaagacctcgcgcgttgggaggagacccgccgcaaaaacccg
ccgctgtcgcacccggtgattcgcacgcacccggttagcggccgcaaagcgttgttcgtc
aacgagggtttcaccacgcggatcaatgagctggaagcggccgagagtgaggccattttg
aaattgctgttcgcccacggcacgcgaccggagttcaccctgcgctggcgttggcaggcg
aacgatgtagccatgtgggacaaccgcgtgactcagcattacgcggtcgacgattaccgg
ccgcagcgccgagtgatgcaccgcgcgacgattctgggtgatgcgccgttttaa

DBGET integrated database retrieval system