Photobacterium ganghwense: FH974_23265 Help Entry FH974_23265       CDS       T07175                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pgh  Photobacterium ganghwense Pathway pgh01100   Metabolic pathways pgh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pgh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FH974_23265    00074 Mycolic acid biosynthesis     FH974_23265   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FH974_23265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QSV16155 LinkDB All DBs Position 2:1576667..1576921 Genome browser AA seq 84 aa AA seqDB search MTTNGNNDNIRDLVMQAIQNIAPEITESDIDPDEDLREECDLDSMDFLNLLDALKRSCGV SIPESDYPQIRSFSALVNYLNART NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgacaaccaacggcaataacgacaacatcagggacctggtcatgcaggctatccaaaac attgcgccggaaatcaccgaaagcgatattgatcctgatgaagatctgcgcgaggaatgc gacctcgattcaatggatttcctcaatctgctggatgccctgaaacgaagctgcggcgtc agcattccggagtctgactacccgcaaatcagatcgttctccgctttggtgaattatctg aacgcgcgcacctga

DBGET integrated database retrieval system