Photobacterium ganghwense: FH974_24615 Help Entry FH974_24615       CDS       T07175                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pgh  Photobacterium ganghwense Pathway pgh01100   Metabolic pathways pgh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pgh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FH974_24615    00074 Mycolic acid biosynthesis     FH974_24615   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FH974_24615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QSV16386 LinkDB All DBs Position 2:complement(1880582..1880851) Genome browser AA seq 89 aa AA seqDB search MEKLHQELKALIIETLNLEDLSIEDIETTAPLFGDGLGLDSIDALELGLAIKNQYSVILD TDDSNTRTNFASVENLAKFISEHRPSASL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggaaaaattacatcaggaattgaaagcactcattattgaaacgctgaatctggaagat ctttcgattgaggatattgaaacgaccgcgccgctgtttggtgatgggctgggattagat tccattgatgcgctggaactgggcctggcaattaaaaatcagtacagcgttattctcgat acggatgacagtaatacgcggactaatttcgcatcggtagaaaatctggccaaatttatt tctgaacatcgtccgtcagcgtcactctga

DBGET integrated database retrieval system