Porphyromonas gingivalis W83: PG_0501
Help
Entry
PG_0501 CDS
T00145
Name
(GenBank) conserved hypothetical protein
KO
K11720
lipopolysaccharide export system permease protein
Organism
pgi
Porphyromonas gingivalis W83
Pathway
pgi02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
pgi00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
PG_0501
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
pgi02000
]
PG_0501
Transporters [BR:
pgi02000
]
ABC transporters, prokaryotic type
ABC-2 type and other transporters
Lipopolysaccharide transporter
PG_0501
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LptF_LptG
Motif
Other DBs
NCBI-ProteinID:
AAQ65695
UniProt:
Q7MWT6
LinkDB
All DBs
Position
540484..541566
Genome browser
AA seq
360 aa
AA seq
DB search
MKRLNRLDKYLIKQFLGTFVFSIILIISVSVVFDINEKIDDFMKPEVSLRSIIFDYYFNF
VPYYANLFSPLFVFISVIFFTSKLAEKSEIIAMLSAGVSFKRLMVPYMLSATVIAILTFL
LNSFVIPPGNATRIDFQNKYIKNKKVQYAESVQLEVKKGVFAFFGSYSDAMRTGYQFSLE
EFKGKQLVSRLTADRIQYDSLYNWRIFNYRIRHFGKYKETVESGSEMDTVIAVRPADFLV
AEDDVETMTTTDLHTYISHQKQRGVGNVKLFEIELHKRYAAIFSAFILTIIGASLSSRKV
KGGMGINIAIGLGLSFAYILFMTVAGTFAISGSLPPFMAAWLPNFVFTVIAVSLYKKAPR
NT seq
1083 nt
NT seq
+upstream
nt +downstream
nt
atgaagaggttgaacaggttagataagtatttgatcaagcagtttttggggacgttcgtc
ttctccatcatcttgatcatatccgtttcggtcgtcttcgacatcaatgagaagatcgat
gactttatgaagccggaggtcagtctgcgcagtatcatattcgattactatttcaacttc
gttccctactacgccaatcttttcagcccgctcttcgtcttcatatcggttatattcttt
acgtcgaagctggctgagaagtccgagatcatcgcgatgctttcggccggagtcagtttc
aagcggctgatggtgccctatatgttgtcggcaacggtgattgccatactgactttcctg
ctcaatagtttcgttatcccaccgggcaatgctacacgaattgattttcagaacaaatac
atcaagaacaagaaggtacagtatgccgagagcgttcagctcgaagtgaagaaaggggtc
tttgcctttttcggatcgtacagcgatgccatgcgaaccggttaccagttcagcctggaa
gagttcaagggcaagcagctcgtctcccgtctgacagcggataggatccaatacgactcg
ctttataactggcgcattttcaactacaggatcaggcacttcggtaagtataaagagacg
gtcgagagcggtagcgagatggacacggtaatagccgtccgcccggcggacttcctcgtg
gcagaggatgatgtggagacgatgacgactaccgacctgcatacctatatatcgcatcag
aagcaaaggggcgtgggcaacgtcaagctctttgagatcgaactgcacaaacgctatgca
gccatcttctctgcctttatcctcaccattatcggtgcttcgctctcttcacgcaaagta
aaaggagggatggggatcaatatcgctatcggtctggggcttagctttgcctatatcctg
tttatgaccgttgccggtacatttgccatcagcggatctttgcctccgtttatggcagct
tggttgcctaacttcgtgtttacggtcattgccgtttccctttataaaaaagctccgcga
tag
DBGET
integrated database retrieval system