Porphyromonas gingivalis W83: PG_1258 Help Entry PG_1258           CDS       T00145                                  Symbol hup-2 Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism pgi  Porphyromonas gingivalis W83 Brite KEGG Orthology (KO) [BR:pgi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pgi03032]     PG_1258 (hup-2)    03036 Chromosome and associated proteins [BR:pgi03036]     PG_1258 (hup-2)    03400 DNA repair and recombination proteins [BR:pgi03400]     PG_1258 (hup-2) DNA replication proteins [BR:pgi03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PG_1258 (hup-2) Chromosome and associated proteins [BR:pgi03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PG_1258 (hup-2) DNA repair and recombination proteins [BR:pgi03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PG_1258 (hup-2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-DNA_bdg FliG_N HU-CCDC81_bac_1 Motif Other DBs NCBI-ProteinID:  AAQ66341 UniProt:  Q7MV42 LinkDB All DBs Position complement(1334674..1334952) Genome browser AA seq 92 aa AA seqDB search MTKADVVNAIAKSTGIDKETTLKVVESFMDTIKDSLSEGDNVYLRGFGSFIVKERAEKTA RNISKQTTIIIPKRNIPAFKPSKIFMSQMKQD NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgacgaaagctgacgtagtgaacgctattgcgaagtcgacagggattgataaagaaacg accctgaaagtcgtagagtcgttcatggacactatcaaagactccctttcggaaggtgat aatgtatatctccgcggatttggtagcttcattgtgaaggaaagagctgagaagacagca cgtaatatttcgaagcagacgactatcatcatccccaaaaggaatattccggcgtttaag ccttcgaaaatctttatgagtcagatgaaacaagactaa

DBGET integrated database retrieval system