Pteropus vampyrus (Indian flying fox): 120583610 Help Entry 120583610         CDS       T07511                                  Name (RefSeq) myosin light chain 6B-like   KO K12751   myosin light chain 6 Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04270   Vascular smooth muscle contraction pgig04530   Tight junction pgig04814   Motor proteins pgig04921   Oxytocin signaling pathway Brite KEGG Orthology (KO) [BR:pgig00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     120583610   09142 Cell motility    04814 Motor proteins     120583610  09150 Organismal Systems   09152 Endocrine system    04921 Oxytocin signaling pathway     120583610   09153 Circulatory system    04270 Vascular smooth muscle contraction     120583610  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pgig04812]     120583610    04147 Exosome [BR:pgig04147]     120583610 Cytoskeleton proteins [BR:pgig04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      120583610 Exosome [BR:pgig04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    120583610   Exosomal proteins of bladder cancer cells    120583610 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_8 EF-hand_6 DUF3565 Motif Other DBs NCBI-GeneID:  120583610 NCBI-ProteinID:  XP_039694883 LinkDB All DBs Position Unknown AA seq 157 aa AA seqDB search MPSAAVPGGGTFGKYLGHKAGAFMKGIGRDGKILYSQHGGVMRALGQNPINAEVLKILGN SESDELKSQRVDFESFLPVLQAVAKNRDQGTYEDYLQGLWVFDEEGNGKVMGAELRCVLT ALREKMTEEEVETVLAGHEESNGRIKYEGFLKLILSI NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atgcccagtgcggcagtgccaggaggtggcacctttgggaagtacttaggtcacaaggcc ggagccttcatgaaggggatcggacgggatggaaagatcctgtacagccagcatgggggt gtgatgagggccctgggccagaaccccataaatgccgaggtgctcaagattctggggaac tccgagagtgatgagctaaagtcccagcgtgtggacttcgagtctttcctgcctgtgctc caggcggtggccaagaaccgggatcaaggcacatatgaggactacctgcaggggctttgg gtgtttgacgaagaagggaatggcaaagtcatgggagcagagctcagatgtgtcctcacc gccctgagagagaagatgactgaagaggaagtggagactgttctggcaggacatgaggag agcaatggtcgcatcaagtatgaaggcttcctgaagctcatcctaagcatctga

DBGET integrated database retrieval system