Pteropus vampyrus (Indian flying fox): 120584612 Help Entry 120584612         CDS       T07511                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04010   MAPK signaling pathway pgig04014   Ras signaling pathway pgig04015   Rap1 signaling pathway pgig04022   cGMP-PKG signaling pathway pgig04066   HIF-1 signaling pathway pgig04068   FoxO signaling pathway pgig04072   Phospholipase D signaling pathway pgig04081   Hormone signaling pgig04114   Oocyte meiosis pgig04140   Autophagy - animal pgig04150   mTOR signaling pathway pgig04151   PI3K-Akt signaling pathway pgig04152   AMPK signaling pathway pgig04211   Longevity regulating pathway pgig04213   Longevity regulating pathway - multiple species pgig04810   Regulation of actin cytoskeleton pgig04910   Insulin signaling pathway pgig04911   Insulin secretion pgig04913   Ovarian steroidogenesis pgig04914   Progesterone-mediated oocyte maturation pgig04917   Prolactin signaling pathway pgig04923   Regulation of lipolysis in adipocytes pgig04930   Type II diabetes mellitus pgig04931   Insulin resistance pgig04932   Non-alcoholic fatty liver disease pgig04940   Type I diabetes mellitus pgig04950   Maturity onset diabetes of the young pgig04960   Aldosterone-regulated sodium reabsorption pgig05010   Alzheimer disease pgig05215   Prostate cancer pgig05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120584612 (INS)    04014 Ras signaling pathway     120584612 (INS)    04015 Rap1 signaling pathway     120584612 (INS)    04066 HIF-1 signaling pathway     120584612 (INS)    04068 FoxO signaling pathway     120584612 (INS)    04072 Phospholipase D signaling pathway     120584612 (INS)    04022 cGMP-PKG signaling pathway     120584612 (INS)    04151 PI3K-Akt signaling pathway     120584612 (INS)    04152 AMPK signaling pathway     120584612 (INS)    04150 mTOR signaling pathway     120584612 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     120584612 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120584612 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     120584612 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120584612 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     120584612 (INS)    04910 Insulin signaling pathway     120584612 (INS)    04923 Regulation of lipolysis in adipocytes     120584612 (INS)    04913 Ovarian steroidogenesis     120584612 (INS)    04914 Progesterone-mediated oocyte maturation     120584612 (INS)    04917 Prolactin signaling pathway     120584612 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     120584612 (INS)   09149 Aging    04211 Longevity regulating pathway     120584612 (INS)    04213 Longevity regulating pathway - multiple species     120584612 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     120584612 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     120584612 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     120584612 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     120584612 (INS)    04940 Type I diabetes mellitus     120584612 (INS)    04950 Maturity onset diabetes of the young     120584612 (INS)    04932 Non-alcoholic fatty liver disease     120584612 (INS)    04931 Insulin resistance     120584612 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pgig04052]     120584612 (INS) Cytokines and neuropeptides [BR:pgig04052]  Neuropeptides   Unclassified    120584612 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  120584612 NCBI-ProteinID:  XP_039696307 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MALWTRLLPLLALLGLWAPTPAPAFVSQHLCGSHLVEALYLVCGERGFFYTPKARRELEG PQGGEVELGGGPGAGSRQALALEGPPQKRGIVDQCCTSICSLYQLENYCN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggccctgtggacgcgcctcctgcccctgctggccctgctgggcctctgggcgcccacg ccggccccggccttcgtcagccagcacctgtgcggctcccacctggtggaggcgctgtac ctggtgtgcggggagcgcggcttcttctacacgcccaaggcccgccgggagctggagggc ccgcagggcggggaggtggagctgggcgggggccccggcgcgggcagccggcaggccctg gcgctggagggccccccgcagaagcgcggcatcgtggaccagtgctgcaccagcatctgc tccctctaccagctggagaactattgcaactag

DBGET integrated database retrieval system