Pteropus vampyrus (Indian flying fox): 120584765 Help Entry 120584765         CDS       T07511                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig03030   DNA replication pgig03410   Base excision repair pgig03420   Nucleotide excision repair pgig03430   Mismatch repair pgig03440   Homologous recombination Brite KEGG Orthology (KO) [BR:pgig00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     120584765 (POLD4)    03410 Base excision repair     120584765 (POLD4)    03420 Nucleotide excision repair     120584765 (POLD4)    03430 Mismatch repair     120584765 (POLD4)    03440 Homologous recombination     120584765 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pgig03032]     120584765 (POLD4)    03400 DNA repair and recombination proteins [BR:pgig03400]     120584765 (POLD4) DNA replication proteins [BR:pgig03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     120584765 (POLD4) DNA repair and recombination proteins [BR:pgig03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       120584765 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      120584765 (POLD4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  120584765 NCBI-ProteinID:  XP_039696655 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MGRKRFITDAFPVVKRREGPAGHCKGKLAPELGEEPQPLSVEEVELELLRQFDLAWQYGP CTGITRLQRWQRAEQMGLEPPPEVRQVLQTHPGDPRFQYSLWHLYPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgggccggaagcggttcattactgatgccttccctgtagtgaagaggagggagggcccc gctggacactgcaaggggaagctggcaccagagctaggggaagagccccagcccctgagc gtggaggaagtggagctggagctgctgaggcagtttgacctggcctggcagtatgggccc tgcacagggatcacacggctgcagcgctggcagcgggcagagcagatgggcttggagcct cccccagaagtacgccaggtgctgcaaacccaccctggagatccccgcttccagtacagc ctctggcatctctatcccctctga

DBGET integrated database retrieval system