KEGG   Pteropus vampyrus (Indian flying fox): 120585069
Entry
120585069         CDS       T07511                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas isoform X1
  KO
K07828  GTPase NRas
Organism
pgig  Pteropus vampyrus (Indian flying fox)
Pathway
pgig01521  EGFR tyrosine kinase inhibitor resistance
pgig01522  Endocrine resistance
pgig04010  MAPK signaling pathway
pgig04012  ErbB signaling pathway
pgig04014  Ras signaling pathway
pgig04015  Rap1 signaling pathway
pgig04062  Chemokine signaling pathway
pgig04068  FoxO signaling pathway
pgig04071  Sphingolipid signaling pathway
pgig04072  Phospholipase D signaling pathway
pgig04137  Mitophagy - animal
pgig04140  Autophagy - animal
pgig04150  mTOR signaling pathway
pgig04151  PI3K-Akt signaling pathway
pgig04210  Apoptosis
pgig04211  Longevity regulating pathway
pgig04213  Longevity regulating pathway - multiple species
pgig04218  Cellular senescence
pgig04360  Axon guidance
pgig04370  VEGF signaling pathway
pgig04371  Apelin signaling pathway
pgig04540  Gap junction
pgig04550  Signaling pathways regulating pluripotency of stem cells
pgig04625  C-type lectin receptor signaling pathway
pgig04650  Natural killer cell mediated cytotoxicity
pgig04660  T cell receptor signaling pathway
pgig04662  B cell receptor signaling pathway
pgig04664  Fc epsilon RI signaling pathway
pgig04714  Thermogenesis
pgig04720  Long-term potentiation
pgig04722  Neurotrophin signaling pathway
pgig04725  Cholinergic synapse
pgig04726  Serotonergic synapse
pgig04730  Long-term depression
pgig04810  Regulation of actin cytoskeleton
pgig04910  Insulin signaling pathway
pgig04912  GnRH signaling pathway
pgig04915  Estrogen signaling pathway
pgig04916  Melanogenesis
pgig04917  Prolactin signaling pathway
pgig04919  Thyroid hormone signaling pathway
pgig04921  Oxytocin signaling pathway
pgig04926  Relaxin signaling pathway
pgig04929  GnRH secretion
pgig04933  AGE-RAGE signaling pathway in diabetic complications
pgig04935  Growth hormone synthesis, secretion and action
pgig05010  Alzheimer disease
pgig05022  Pathways of neurodegeneration - multiple diseases
pgig05034  Alcoholism
pgig05160  Hepatitis C
pgig05161  Hepatitis B
pgig05163  Human cytomegalovirus infection
pgig05165  Human papillomavirus infection
pgig05166  Human T-cell leukemia virus 1 infection
pgig05167  Kaposi sarcoma-associated herpesvirus infection
pgig05170  Human immunodeficiency virus 1 infection
pgig05200  Pathways in cancer
pgig05203  Viral carcinogenesis
pgig05205  Proteoglycans in cancer
pgig05206  MicroRNAs in cancer
pgig05207  Chemical carcinogenesis - receptor activation
pgig05208  Chemical carcinogenesis - reactive oxygen species
pgig05210  Colorectal cancer
pgig05211  Renal cell carcinoma
pgig05213  Endometrial cancer
pgig05214  Glioma
pgig05215  Prostate cancer
pgig05216  Thyroid cancer
pgig05218  Melanoma
pgig05219  Bladder cancer
pgig05220  Chronic myeloid leukemia
pgig05221  Acute myeloid leukemia
pgig05223  Non-small cell lung cancer
pgig05224  Breast cancer
pgig05225  Hepatocellular carcinoma
pgig05226  Gastric cancer
pgig05230  Central carbon metabolism in cancer
pgig05231  Choline metabolism in cancer
pgig05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pgig05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pgig00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    120585069 (NRAS)
   04012 ErbB signaling pathway
    120585069 (NRAS)
   04014 Ras signaling pathway
    120585069 (NRAS)
   04015 Rap1 signaling pathway
    120585069 (NRAS)
   04370 VEGF signaling pathway
    120585069 (NRAS)
   04371 Apelin signaling pathway
    120585069 (NRAS)
   04068 FoxO signaling pathway
    120585069 (NRAS)
   04072 Phospholipase D signaling pathway
    120585069 (NRAS)
   04071 Sphingolipid signaling pathway
    120585069 (NRAS)
   04151 PI3K-Akt signaling pathway
    120585069 (NRAS)
   04150 mTOR signaling pathway
    120585069 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    120585069 (NRAS)
   04137 Mitophagy - animal
    120585069 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    120585069 (NRAS)
   04218 Cellular senescence
    120585069 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    120585069 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    120585069 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    120585069 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    120585069 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    120585069 (NRAS)
   04660 T cell receptor signaling pathway
    120585069 (NRAS)
   04662 B cell receptor signaling pathway
    120585069 (NRAS)
   04664 Fc epsilon RI signaling pathway
    120585069 (NRAS)
   04062 Chemokine signaling pathway
    120585069 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    120585069 (NRAS)
   04929 GnRH secretion
    120585069 (NRAS)
   04912 GnRH signaling pathway
    120585069 (NRAS)
   04915 Estrogen signaling pathway
    120585069 (NRAS)
   04917 Prolactin signaling pathway
    120585069 (NRAS)
   04921 Oxytocin signaling pathway
    120585069 (NRAS)
   04926 Relaxin signaling pathway
    120585069 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    120585069 (NRAS)
   04919 Thyroid hormone signaling pathway
    120585069 (NRAS)
   04916 Melanogenesis
    120585069 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    120585069 (NRAS)
   04726 Serotonergic synapse
    120585069 (NRAS)
   04720 Long-term potentiation
    120585069 (NRAS)
   04730 Long-term depression
    120585069 (NRAS)
   04722 Neurotrophin signaling pathway
    120585069 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    120585069 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    120585069 (NRAS)
   04213 Longevity regulating pathway - multiple species
    120585069 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    120585069 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    120585069 (NRAS)
   05206 MicroRNAs in cancer
    120585069 (NRAS)
   05205 Proteoglycans in cancer
    120585069 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    120585069 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    120585069 (NRAS)
   05203 Viral carcinogenesis
    120585069 (NRAS)
   05230 Central carbon metabolism in cancer
    120585069 (NRAS)
   05231 Choline metabolism in cancer
    120585069 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    120585069 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    120585069 (NRAS)
   05225 Hepatocellular carcinoma
    120585069 (NRAS)
   05226 Gastric cancer
    120585069 (NRAS)
   05214 Glioma
    120585069 (NRAS)
   05216 Thyroid cancer
    120585069 (NRAS)
   05221 Acute myeloid leukemia
    120585069 (NRAS)
   05220 Chronic myeloid leukemia
    120585069 (NRAS)
   05218 Melanoma
    120585069 (NRAS)
   05211 Renal cell carcinoma
    120585069 (NRAS)
   05219 Bladder cancer
    120585069 (NRAS)
   05215 Prostate cancer
    120585069 (NRAS)
   05213 Endometrial cancer
    120585069 (NRAS)
   05224 Breast cancer
    120585069 (NRAS)
   05223 Non-small cell lung cancer
    120585069 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    120585069 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    120585069 (NRAS)
   05161 Hepatitis B
    120585069 (NRAS)
   05160 Hepatitis C
    120585069 (NRAS)
   05163 Human cytomegalovirus infection
    120585069 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    120585069 (NRAS)
   05165 Human papillomavirus infection
    120585069 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    120585069 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    120585069 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    120585069 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    120585069 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    120585069 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    120585069 (NRAS)
   01522 Endocrine resistance
    120585069 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pgig04131]
    120585069 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgig04147]
    120585069 (NRAS)
   04031 GTP-binding proteins [BR:pgig04031]
    120585069 (NRAS)
Membrane trafficking [BR:pgig04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    120585069 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    120585069 (NRAS)
Exosome [BR:pgig04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   120585069 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   120585069 (NRAS)
  Exosomal proteins of breast cancer cells
   120585069 (NRAS)
  Exosomal proteins of colorectal cancer cells
   120585069 (NRAS)
GTP-binding proteins [BR:pgig04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    120585069 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 120585069
NCBI-ProteinID: XP_039697211
UniProt: A0A6P3QKY0
LinkDB
Position
Unknown
AA seq 207 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLTTVKVLASEKSHCQAALTPAL
VLTSWRTLPLSPSPVSQRRARYFPSSR
NT seq 624 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgacc
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggtgatagacggtgagacctgtctgttggacatcctggacacagctgga
caggaggagtacagtgccatgagagaccagtacatgaggacaggcgaaggcttcctctgc
gtgtttgccatcaataacagcaagtcatttgcagatattaacctctacagggaacagatt
aagcgagtaaaggactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccacgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactgaca
actgttaaagttctagcatcagaaaagagccactgtcaagctgcactgacacccgccctg
gtcctgacttcctggaggacactccccctgtcgccctctcctgtctcacagagacgcgcc
cgctacttccccagctctcggtag

DBGET integrated database retrieval system