Pteropus vampyrus (Indian flying fox): 120585069 Help Entry 120585069         CDS       T07511                                  Symbol NRAS Name (RefSeq) GTPase NRas isoform X1   KO K07828   GTPase NRas Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig01521   EGFR tyrosine kinase inhibitor resistance pgig01522   Endocrine resistance pgig04010   MAPK signaling pathway pgig04012   ErbB signaling pathway pgig04014   Ras signaling pathway pgig04015   Rap1 signaling pathway pgig04062   Chemokine signaling pathway pgig04068   FoxO signaling pathway pgig04071   Sphingolipid signaling pathway pgig04072   Phospholipase D signaling pathway pgig04137   Mitophagy - animal pgig04140   Autophagy - animal pgig04150   mTOR signaling pathway pgig04151   PI3K-Akt signaling pathway pgig04210   Apoptosis pgig04211   Longevity regulating pathway pgig04213   Longevity regulating pathway - multiple species pgig04218   Cellular senescence pgig04360   Axon guidance pgig04370   VEGF signaling pathway pgig04371   Apelin signaling pathway pgig04540   Gap junction pgig04550   Signaling pathways regulating pluripotency of stem cells pgig04625   C-type lectin receptor signaling pathway pgig04650   Natural killer cell mediated cytotoxicity pgig04660   T cell receptor signaling pathway pgig04662   B cell receptor signaling pathway pgig04664   Fc epsilon RI signaling pathway pgig04714   Thermogenesis pgig04720   Long-term potentiation pgig04722   Neurotrophin signaling pathway pgig04725   Cholinergic synapse pgig04726   Serotonergic synapse pgig04730   Long-term depression pgig04810   Regulation of actin cytoskeleton pgig04910   Insulin signaling pathway pgig04912   GnRH signaling pathway pgig04915   Estrogen signaling pathway pgig04916   Melanogenesis pgig04917   Prolactin signaling pathway pgig04919   Thyroid hormone signaling pathway pgig04921   Oxytocin signaling pathway pgig04926   Relaxin signaling pathway pgig04929   GnRH secretion pgig04933   AGE-RAGE signaling pathway in diabetic complications pgig04935   Growth hormone synthesis, secretion and action pgig05010   Alzheimer disease pgig05022   Pathways of neurodegeneration - multiple diseases pgig05034   Alcoholism pgig05160   Hepatitis C pgig05161   Hepatitis B pgig05163   Human cytomegalovirus infection pgig05165   Human papillomavirus infection pgig05166   Human T-cell leukemia virus 1 infection pgig05167   Kaposi sarcoma-associated herpesvirus infection pgig05170   Human immunodeficiency virus 1 infection pgig05200   Pathways in cancer pgig05203   Viral carcinogenesis pgig05205   Proteoglycans in cancer pgig05206   MicroRNAs in cancer pgig05207   Chemical carcinogenesis - receptor activation pgig05208   Chemical carcinogenesis - reactive oxygen species pgig05210   Colorectal cancer pgig05211   Renal cell carcinoma pgig05213   Endometrial cancer pgig05214   Glioma pgig05215   Prostate cancer pgig05216   Thyroid cancer pgig05218   Melanoma pgig05219   Bladder cancer pgig05220   Chronic myeloid leukemia pgig05221   Acute myeloid leukemia pgig05223   Non-small cell lung cancer pgig05224   Breast cancer pgig05225   Hepatocellular carcinoma pgig05226   Gastric cancer pgig05230   Central carbon metabolism in cancer pgig05231   Choline metabolism in cancer pgig05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pgig05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120585069 (NRAS)    04012 ErbB signaling pathway     120585069 (NRAS)    04014 Ras signaling pathway     120585069 (NRAS)    04015 Rap1 signaling pathway     120585069 (NRAS)    04370 VEGF signaling pathway     120585069 (NRAS)    04371 Apelin signaling pathway     120585069 (NRAS)    04068 FoxO signaling pathway     120585069 (NRAS)    04072 Phospholipase D signaling pathway     120585069 (NRAS)    04071 Sphingolipid signaling pathway     120585069 (NRAS)    04151 PI3K-Akt signaling pathway     120585069 (NRAS)    04150 mTOR signaling pathway     120585069 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120585069 (NRAS)    04137 Mitophagy - animal     120585069 (NRAS)   09143 Cell growth and death    04210 Apoptosis     120585069 (NRAS)    04218 Cellular senescence     120585069 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     120585069 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     120585069 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120585069 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120585069 (NRAS)    04650 Natural killer cell mediated cytotoxicity     120585069 (NRAS)    04660 T cell receptor signaling pathway     120585069 (NRAS)    04662 B cell receptor signaling pathway     120585069 (NRAS)    04664 Fc epsilon RI signaling pathway     120585069 (NRAS)    04062 Chemokine signaling pathway     120585069 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     120585069 (NRAS)    04929 GnRH secretion     120585069 (NRAS)    04912 GnRH signaling pathway     120585069 (NRAS)    04915 Estrogen signaling pathway     120585069 (NRAS)    04917 Prolactin signaling pathway     120585069 (NRAS)    04921 Oxytocin signaling pathway     120585069 (NRAS)    04926 Relaxin signaling pathway     120585069 (NRAS)    04935 Growth hormone synthesis, secretion and action     120585069 (NRAS)    04919 Thyroid hormone signaling pathway     120585069 (NRAS)    04916 Melanogenesis     120585069 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     120585069 (NRAS)    04726 Serotonergic synapse     120585069 (NRAS)    04720 Long-term potentiation     120585069 (NRAS)    04730 Long-term depression     120585069 (NRAS)    04722 Neurotrophin signaling pathway     120585069 (NRAS)   09158 Development and regeneration    04360 Axon guidance     120585069 (NRAS)   09149 Aging    04211 Longevity regulating pathway     120585069 (NRAS)    04213 Longevity regulating pathway - multiple species     120585069 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     120585069 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120585069 (NRAS)    05206 MicroRNAs in cancer     120585069 (NRAS)    05205 Proteoglycans in cancer     120585069 (NRAS)    05207 Chemical carcinogenesis - receptor activation     120585069 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     120585069 (NRAS)    05203 Viral carcinogenesis     120585069 (NRAS)    05230 Central carbon metabolism in cancer     120585069 (NRAS)    05231 Choline metabolism in cancer     120585069 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     120585069 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     120585069 (NRAS)    05225 Hepatocellular carcinoma     120585069 (NRAS)    05226 Gastric cancer     120585069 (NRAS)    05214 Glioma     120585069 (NRAS)    05216 Thyroid cancer     120585069 (NRAS)    05221 Acute myeloid leukemia     120585069 (NRAS)    05220 Chronic myeloid leukemia     120585069 (NRAS)    05218 Melanoma     120585069 (NRAS)    05211 Renal cell carcinoma     120585069 (NRAS)    05219 Bladder cancer     120585069 (NRAS)    05215 Prostate cancer     120585069 (NRAS)    05213 Endometrial cancer     120585069 (NRAS)    05224 Breast cancer     120585069 (NRAS)    05223 Non-small cell lung cancer     120585069 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120585069 (NRAS)    05170 Human immunodeficiency virus 1 infection     120585069 (NRAS)    05161 Hepatitis B     120585069 (NRAS)    05160 Hepatitis C     120585069 (NRAS)    05163 Human cytomegalovirus infection     120585069 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     120585069 (NRAS)    05165 Human papillomavirus infection     120585069 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     120585069 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     120585069 (NRAS)   09165 Substance dependence    05034 Alcoholism     120585069 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120585069 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     120585069 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     120585069 (NRAS)    01522 Endocrine resistance     120585069 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pgig04131]     120585069 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgig04147]     120585069 (NRAS)    04031 GTP-binding proteins [BR:pgig04031]     120585069 (NRAS) Membrane trafficking [BR:pgig04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     120585069 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     120585069 (NRAS) Exosome [BR:pgig04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120585069 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    120585069 (NRAS)   Exosomal proteins of breast cancer cells    120585069 (NRAS)   Exosomal proteins of colorectal cancer cells    120585069 (NRAS) GTP-binding proteins [BR:pgig04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120585069 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  120585069 NCBI-ProteinID:  XP_039697211 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLTTVKVLASEKSHCQAALTPAL VLTSWRTLPLSPSPVSQRRARYFPSSR NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgacc atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggtgatagacggtgagacctgtctgttggacatcctggacacagctgga caggaggagtacagtgccatgagagaccagtacatgaggacaggcgaaggcttcctctgc gtgtttgccatcaataacagcaagtcatttgcagatattaacctctacagggaacagatt aagcgagtaaaggactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccacgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactgaca actgttaaagttctagcatcagaaaagagccactgtcaagctgcactgacacccgccctg gtcctgacttcctggaggacactccccctgtcgccctctcctgtctcacagagacgcgcc cgctacttccccagctctcggtag

DBGET integrated database retrieval system