Pteropus vampyrus (Indian flying fox): 120585181 Help Entry 120585181         CDS       T07511                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig03082   ATP-dependent chromatin remodeling pgig04217   Necroptosis pgig04613   Neutrophil extracellular trap formation pgig05034   Alcoholism pgig05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pgig00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     120585181  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120585181  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120585181  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     120585181   09165 Substance dependence    05034 Alcoholism     120585181  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pgig03036]     120585181   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgig04147]     120585181 Chromosome and associated proteins [BR:pgig03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120585181 Exosome [BR:pgig04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120585181 SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Histone_ABTB Clp_N Motif Other DBs NCBI-GeneID:  120585181 NCBI-ProteinID:  XP_039697398 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgcggaaaacagggaggcaaagctcgtgccaaggccaagtcccgctcgtcc cgggctggcctccagtttcccgtgggccgagtgcaccgcctgctgcgcaaaggcaactac gccgagcgggtgggggccggcgcgcccgtctacatggcggccgtgctcgagtacctgacg gcggagatcctggagctggctggcaacgccgcccgagacaacaagaagacgcgcatcatc cctcgtcacctgcagctggccatccgcaacgacgaggagctgaacaagctgctgggcaaa gtcaccatcgcccagggcggtgttttgcccaacatccaggccgttttattaccaaagaag accgaaagccacaaagccaaaagcaagtaa

DBGET integrated database retrieval system