KEGG   Pteropus giganteus (Indian flying fox): 120585806
Entry
120585806         CDS       T07511                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X1
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
pgig  Pteropus giganteus (Indian flying fox)
Pathway
pgig04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:pgig00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    120585806 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pgig04050]
    120585806 (TNFRSF8)
   04090 CD molecules [BR:pgig04090]
    120585806 (TNFRSF8)
Cytokine receptors [BR:pgig04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   120585806 (TNFRSF8)
CD molecules [BR:pgig04090]
 Proteins
  120585806 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 120585806
NCBI-ProteinID: XP_039698122
LinkDB
Position
Unknown
AA seq 484 aa
MFCVTSATNSCARCSPHSVCPKGKIVKFQGTAERDTVCERPSPGTSRDCSSSPGDCKALA
SDTTPHAKPILTSASSDAKTTLLGGDLTPEDDSKMMRAPGSAHSAGKPGPEPGLSPQQPC
PQGSTNCRKQCEQDYYLDRDGRCTACVSCSRDDLVEKTPCTWNSSRVCECRPGMFCVTLA
TNSCARCIACPVFPPGMVQGTAERDTTHEPSPLGTHLNCSTNPEDIKTPASPVPSRIPLS
KGHGGGVTPPSGYNSISTSAAVSSSSTGRPRLVSGPALLCLILVLVVVVGSSSFFLCHRR
ACWKWIRQKLHLCYPVQTFRPKPEPVGSRPQRNPILKGSVSVTEPCADELRLMSPLAVAT
CPDVGTTCLERLQLLDASPASSPPSLGDVPEPRVTAEHTNNRIEKIYIMKADTVIVGTVK
TEVPEGRGLAGPAEPELEEDLEVDHAPHYPEQETEPPLGSCGSVMFSVEEEGKEDPLPMT
ASEK
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgttctgtgtcacatcagccaccaactcctgtgcccgctgctccccgcactctgtctgc
cccaaagggaagattgtcaagttccagggtacagcggagagggacacagtctgcgagcgg
ccctccccagggaccagccgtgactgcagctccagcccaggggactgcaaggcgctagcc
agtgacaccaccccccacgccaaacccatcctgacctcagcaagctccgatgccaagacc
acgcttcttggaggggacctcaccccggaagatgattccaaaatgatgagggctcccggc
tctgcccactccgcggggaagcccgggccggagccagggctgtccccacagcagccgtgc
cctcaggggtccactaactgcaggaagcagtgcgagcaggattactacctggacagggac
ggccgctgcacggcctgcgtgagctgttcaagagatgacctcgtggagaagacaccttgc
acgtggaactcctcccgcgtctgtgaatgtcgacctggcatgttctgtgtcacactggct
accaactcctgtgcccgctgcatcgcctgtcccgtcttcccaccagggatggtccagggt
acagctgagcgggacaccacccatgaaccatctcccctggggactcacctcaactgcagc
accaacccagaggacatcaaaacgcccgccagccctgtcccctcccggatccccctgtcc
aaggggcatggagggggtgtcacccccccctcggggtacaactccatctcaacgagtgct
gccgtctcttcctcctccacgggaaggccccgtctggtttcaggacccgcgctcctctgt
ttgatcctcgtgctggtcgtggtcgtcggctccagctccttcttcctgtgccaccgcagg
gcctgctggaagtggattcggcagaagctccacctgtgctacccagtccagaccttccgg
cccaagccggagcccgtgggttctaggccccagaggaatcccatactgaaggggagcgta
tcggtgacagagccctgcgcagacgagctgaggttaatgagccccctggccgtggcgacc
tgccccgacgtggggacaacctgcctggaaaggctgcagctgctggatgccagcccagct
agcagccccccgtcccttggggacgttcctgagccccgggtcaccgcggagcataccaat
aacaggatcgagaaaatctatatcatgaaggccgacacagtgattgtggggaccgtgaag
acggaggtgcccgagggccggggcctggcggggccggcagagcctgagctcgaagaggac
ctggaagtggaccatgcgcctcactacccggagcaggagaccgaaccgcctctgggcagt
tgcgggagcgtcatgttttcggtcgaggaggagggaaaggaggaccccttgcccatgact
gcctctgagaaatga

DBGET integrated database retrieval system