Pteropus vampyrus (Indian flying fox): 120592534 Help Entry 120592534         CDS       T07511                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04613   Neutrophil extracellular trap formation pgig05034   Alcoholism pgig05202   Transcriptional misregulation in cancer pgig05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pgig00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120592534  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     120592534   09163 Immune disease    05322 Systemic lupus erythematosus     120592534   09165 Substance dependence    05034 Alcoholism     120592534  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pgig03036]     120592534   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgig04147]     120592534 Chromosome and associated proteins [BR:pgig03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120592534 Exosome [BR:pgig04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120592534 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  120592534 NCBI-ProteinID:  XP_039706212 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcaccaagcagacggcccgcaagtccacgggcgggaaggccccgcgcaaacag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggcgctgcgcgagatccgccgctaccagaagtccacggag ctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgtgcgaggcctac ctggtggggctgttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagcgggcctga

DBGET integrated database retrieval system