Pteropus giganteus (Indian flying fox): 120592536 Help Entry 120592536         CDS       T07511                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism pgig  Pteropus giganteus (Indian flying fox) Pathway pgig04613   Neutrophil extracellular trap formation pgig05034   Alcoholism pgig05203   Viral carcinogenesis pgig05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pgig00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120592536  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     120592536   09163 Immune disease    05322 Systemic lupus erythematosus     120592536   09165 Substance dependence    05034 Alcoholism     120592536  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pgig03036]     120592536 Chromosome and associated proteins [BR:pgig03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120592536 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  120592536 NCBI-ProteinID:  XP_039706214 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaaaggcgggaaggggctcggcaaggggggagccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcgcctggcgcgg cgcggcggcgtcaagcgcatctccgggctcatctacgaggagacccgcggggtgctcaag gtcttcctggagaacgtgattcgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcacgctctacggc ttcgggggctga

DBGET integrated database retrieval system