Pteropus vampyrus (Indian flying fox): 120592799 Help Entry 120592799         CDS       T07511                                  Name (RefSeq) histone H2A-Bbd type 2/3-like   KO K11251   histone H2A Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig03082   ATP-dependent chromatin remodeling pgig04217   Necroptosis pgig04613   Neutrophil extracellular trap formation pgig05034   Alcoholism pgig05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pgig00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     120592799  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120592799  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120592799  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     120592799   09165 Substance dependence    05034 Alcoholism     120592799  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pgig03036]     120592799   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgig04147]     120592799 Chromosome and associated proteins [BR:pgig03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120592799 Exosome [BR:pgig04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120592799 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  120592799 NCBI-ProteinID:  XP_039706414 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MPGRRSQGESSRRRRRRRSRARSRSARAELSFSVSHMERLLREGRYAQRLNWSTPIFLAA VIQYMTAKVLELAGDEAQKTGRRCITPEFLDMAVHNNSLLCDFFRTTIISQVAPPWD NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgccgggacggaggagccagggagagtcgtccagacgccggagacggagacggagccgg gcccgctcccgcagcgccagagctgagctgtcgttctccgtgagccacatggagcgtctc ctgcgcgaaggccgctacgcccagcgcctgaattggtccacaccgatcttcctggcagcg gtcatccagtacatgacggccaaggtcctggagctggcgggcgacgaggcccagaagacc ggccgcaggtgcatcaccccggagttcctcgacatggcggtccacaacaactcgctgctc tgcgacttcttccgcaccaccatcatttcccaggtggcccccccctgggattag

DBGET integrated database retrieval system