Pteropus vampyrus (Indian flying fox): 120593744 Help Entry 120593744         CDS       T07511                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig01523   Antifolate resistance pgig04010   MAPK signaling pathway pgig04060   Cytokine-cytokine receptor interaction pgig04064   NF-kappa B signaling pathway pgig04217   Necroptosis pgig04380   Osteoclast differentiation pgig04620   Toll-like receptor signaling pathway pgig04621   NOD-like receptor signaling pathway pgig04623   Cytosolic DNA-sensing pathway pgig04625   C-type lectin receptor signaling pathway pgig04640   Hematopoietic cell lineage pgig04657   IL-17 signaling pathway pgig04659   Th17 cell differentiation pgig04668   TNF signaling pathway pgig04750   Inflammatory mediator regulation of TRP channels pgig04932   Non-alcoholic fatty liver disease pgig04933   AGE-RAGE signaling pathway in diabetic complications pgig04936   Alcoholic liver disease pgig04940   Type I diabetes mellitus pgig05010   Alzheimer disease pgig05020   Prion disease pgig05022   Pathways of neurodegeneration - multiple diseases pgig05132   Salmonella infection pgig05133   Pertussis pgig05134   Legionellosis pgig05135   Yersinia infection pgig05140   Leishmaniasis pgig05142   Chagas disease pgig05143   African trypanosomiasis pgig05144   Malaria pgig05146   Amoebiasis pgig05152   Tuberculosis pgig05162   Measles pgig05163   Human cytomegalovirus infection pgig05164   Influenza A pgig05168   Herpes simplex virus 1 infection pgig05171   Coronavirus disease - COVID-19 pgig05321   Inflammatory bowel disease pgig05323   Rheumatoid arthritis pgig05332   Graft-versus-host disease pgig05417   Lipid and atherosclerosis pgig05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120593744 (IL1B)    04064 NF-kappa B signaling pathway     120593744 (IL1B)    04668 TNF signaling pathway     120593744 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120593744 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120593744 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     120593744 (IL1B)    04620 Toll-like receptor signaling pathway     120593744 (IL1B)    04621 NOD-like receptor signaling pathway     120593744 (IL1B)    04623 Cytosolic DNA-sensing pathway     120593744 (IL1B)    04625 C-type lectin receptor signaling pathway     120593744 (IL1B)    04659 Th17 cell differentiation     120593744 (IL1B)    04657 IL-17 signaling pathway     120593744 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     120593744 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     120593744 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     120593744 (IL1B)    05164 Influenza A     120593744 (IL1B)    05162 Measles     120593744 (IL1B)    05168 Herpes simplex virus 1 infection     120593744 (IL1B)    05163 Human cytomegalovirus infection     120593744 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     120593744 (IL1B)    05135 Yersinia infection     120593744 (IL1B)    05133 Pertussis     120593744 (IL1B)    05134 Legionellosis     120593744 (IL1B)    05152 Tuberculosis     120593744 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     120593744 (IL1B)    05144 Malaria     120593744 (IL1B)    05140 Leishmaniasis     120593744 (IL1B)    05142 Chagas disease     120593744 (IL1B)    05143 African trypanosomiasis     120593744 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     120593744 (IL1B)    05321 Inflammatory bowel disease     120593744 (IL1B)    05332 Graft-versus-host disease     120593744 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     120593744 (IL1B)    05020 Prion disease     120593744 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     120593744 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120593744 (IL1B)    05418 Fluid shear stress and atherosclerosis     120593744 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     120593744 (IL1B)    04936 Alcoholic liver disease     120593744 (IL1B)    04932 Non-alcoholic fatty liver disease     120593744 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     120593744 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     120593744 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pgig04052]     120593744 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:pgig00536]     120593744 (IL1B) Cytokines and neuropeptides [BR:pgig04052]  Cytokines   Interleukins    120593744 (IL1B) Glycosaminoglycan binding proteins [BR:pgig00536]  Heparan sulfate / Heparin   Cytokines    120593744 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1_propep IL1 Motif Other DBs NCBI-GeneID:  120593744 NCBI-ProteinID:  XP_039707586 LinkDB All DBs Position Unknown AA seq 279 aa AA seqDB search MAIKQRGRNWQTAHPCEDNGSLWAPLSAASLHCQVSGAAMAAVPELTSEAMAYYSGNEND LFFEADGPTQTKRPFHNLELGSLGDSGIQLQVSPQLCSTSPGQVVSVLVALEELRAVPTV CTQDLQEDDLRSLFFFIFEEEPLSCTWDDGYVCDAPLQSLSCRLRDINQKSLVLSGPHEL QALHLNRQDASRQVVFCMSFMPGEENDDKIPVALGIKEKNLYLSCVMKDRKPTLQLEVSE WQRLTALPRLLQGPLATTNFQDSQLPSPLDTLTTLRTYK NT seq 840 nt NT seq  +upstreamnt  +downstreamnt atggccataaaacagcgagggagaaactggcagacagcacacccttgcgaggacaacggg tctctctgggctccattatctgcagctagccttcattgtcaggtttctggagcagccatg gcagcagtgcctgaactcaccagtgaagcgatggcttactacagtggcaatgagaacgac ctcttctttgaggctgacggccccacgcagaccaagcgccccttccacaacctggagctc ggctcgctgggcgacagcggcatccagctgcaggtctcaccccagctatgcagcacaagt cctgggcaggtggtgtcggtcctggtggctttggaggagctgagggcagtgcccaccgtc tgcacacaggacctccaggaggatgacctgagaagtctcttcttcttcatctttgaagaa gagcccctcagctgcacgtgggacgacgggtacgtgtgcgatgcgcccctgcagtcgctg agctgcaggctccgggacataaaccagaagtccctggtgctatctggaccccacgagctg caggccctccacctcaacagacaggatgcaagccgacaagtggtgttctgcatgagcttc atgccaggagaagagaacgatgacaagatcccagtggccttgggcatcaaggaaaagaac ctgtacctgtcctgtgtgatgaaggacaggaagcccactctgcagctggaggtgagtgag tggcagaggctgacagccctccccaggctcctccaagggcccctggccaccaccaacttc caagacagccagctaccttctcccctagacaccctgacaacccttcgcacatataaataa

DBGET integrated database retrieval system