Pteropus vampyrus (Indian flying fox): 120596960 Help Entry 120596960         CDS       T07511                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04010   MAPK signaling pathway pgig04020   Calcium signaling pathway pgig04022   cGMP-PKG signaling pathway pgig04114   Oocyte meiosis pgig04218   Cellular senescence pgig04310   Wnt signaling pathway pgig04360   Axon guidance pgig04370   VEGF signaling pathway pgig04380   Osteoclast differentiation pgig04625   C-type lectin receptor signaling pathway pgig04650   Natural killer cell mediated cytotoxicity pgig04658   Th1 and Th2 cell differentiation pgig04659   Th17 cell differentiation pgig04660   T cell receptor signaling pathway pgig04662   B cell receptor signaling pathway pgig04720   Long-term potentiation pgig04724   Glutamatergic synapse pgig04921   Oxytocin signaling pathway pgig04922   Glucagon signaling pathway pgig04924   Renin secretion pgig05010   Alzheimer disease pgig05014   Amyotrophic lateral sclerosis pgig05020   Prion disease pgig05022   Pathways of neurodegeneration - multiple diseases pgig05031   Amphetamine addiction pgig05152   Tuberculosis pgig05163   Human cytomegalovirus infection pgig05166   Human T-cell leukemia virus 1 infection pgig05167   Kaposi sarcoma-associated herpesvirus infection pgig05170   Human immunodeficiency virus 1 infection pgig05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pgig05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120596960 (PPP3R2)    04310 Wnt signaling pathway     120596960 (PPP3R2)    04370 VEGF signaling pathway     120596960 (PPP3R2)    04020 Calcium signaling pathway     120596960 (PPP3R2)    04022 cGMP-PKG signaling pathway     120596960 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     120596960 (PPP3R2)    04218 Cellular senescence     120596960 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120596960 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     120596960 (PPP3R2)    04660 T cell receptor signaling pathway     120596960 (PPP3R2)    04658 Th1 and Th2 cell differentiation     120596960 (PPP3R2)    04659 Th17 cell differentiation     120596960 (PPP3R2)    04662 B cell receptor signaling pathway     120596960 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     120596960 (PPP3R2)    04921 Oxytocin signaling pathway     120596960 (PPP3R2)    04924 Renin secretion     120596960 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     120596960 (PPP3R2)    04720 Long-term potentiation     120596960 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     120596960 (PPP3R2)    04380 Osteoclast differentiation     120596960 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     120596960 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120596960 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     120596960 (PPP3R2)    05163 Human cytomegalovirus infection     120596960 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     120596960 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     120596960 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     120596960 (PPP3R2)    05014 Amyotrophic lateral sclerosis     120596960 (PPP3R2)    05020 Prion disease     120596960 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     120596960 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     120596960 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120596960 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pgig01009]     120596960 (PPP3R2) Protein phosphatases and associated proteins [BR:pgig01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      120596960 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_FSTL1 EH SPARC_Ca_bdg EF-hand_9 USP32_N IL1_propep flgK_1st_1 Motif Other DBs NCBI-GeneID:  120596960 NCBI-ProteinID:  XP_039711474 UniProt:  A0A6P3QI72 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPEEMCSHFDNDEIKRLSKSFKKLDLDSSGTLSVDEFLSLSELQQNPLVQRVIE VFDTDGNGEVDFKEFILGTSQFSVKGDKEQKLRFAFNIYDIDKDGYISNGELFQVLKMMV GGNLKDWQLQQLVDKTIIILDTDGDGKISFEEFSAVVGGLEIHKKLVVVV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atggggaatgaggccagttacccggaggagatgtgctcccacttcgataacgatgaaatt aaaaggttaagcaagagttttaagaagctggacttggactcttcggggactctgagcgtg gacgagttcttgtccctgtccgagctgcagcagaacccgttggtgcagcgagtgatcgag gtctttgacaccgacggcaacggagaagtggacttcaaggaattcatcttggggacctcc cagttcagtgtcaagggggataaggagcagaagctaaggtttgctttcaacatttacgac atagataaagacggctacatttccaacggggagctcttccaggtgctgaagatgatggtg gggggcaacctgaaagactggcagttacagcagctggtggacaaaaccatcatcatcctg gatacagacggcgatgggaaaatatccttcgaggaattcagtgctgtagttggaggccta gagatccacaagaagctggtggtagttgtgtga

DBGET integrated database retrieval system