Pteropus vampyrus (Indian flying fox): 120596992 Help Entry 120596992         CDS       T07511                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04613   Neutrophil extracellular trap formation pgig05034   Alcoholism pgig05202   Transcriptional misregulation in cancer pgig05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pgig00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120596992  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     120596992   09163 Immune disease    05322 Systemic lupus erythematosus     120596992   09165 Substance dependence    05034 Alcoholism     120596992  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pgig03036]     120596992   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgig04147]     120596992 Chromosome and associated proteins [BR:pgig03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120596992 Exosome [BR:pgig04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120596992 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C Motif Other DBs NCBI-GeneID:  120596992 NCBI-ProteinID:  XP_039711523 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search MADTKPTTSNSTHGKALRKQLATKAPSKSAPSTGEVKKPYCYRPSTIALCEVRRYQKSTE LIRKLSFQHLVREIAQDIKTDLCFQNAAIGALQESSEAYLVGLFEDTNLCDIHAKRVTIM PKGIYLAHRIHGKHA NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggctgatacaaagccaactaccagcaattccacccatggtaaagcactgaggaagcaa ctggctacaaaagcccctagcaagagtgcgccctcgactggagaagtaaagaaaccttat tgttacaggcctagtaccatagcactatgtgaagttagacgttatcagaaatccactgaa ctgattcgcaaactttccttccagcacctggtgcgagaaattgctcaagacatcaaaaca gatctgtgcttccagaatgcagctattggtgctttgcaggagtcaagtgaagcctatctg gttggcctttttgaagacaccaacctgtgtgatatccatgccaagcgtgtaactattatg ccaaaaggcatttacttagcacaccgcatacatggaaaacatgcttaa

DBGET integrated database retrieval system