Pteropus vampyrus (Indian flying fox): 120597671 Help Entry 120597671         CDS       T07511                                  Symbol PSMB9 Name (RefSeq) proteasome subunit beta type-9   KO K02741   20S proteasome subunit beta 9 [EC:3.4.25.1] Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig03050   Proteasome Brite KEGG Orthology (KO) [BR:pgig00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     120597671 (PSMB9)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:pgig01002]     120597671 (PSMB9)   09182 Protein families: genetic information processing    03051 Proteasome [BR:pgig03051]     120597671 (PSMB9) Enzymes [BR:pgig01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.25  Threonine endopeptidases     3.4.25.1  proteasome endopeptidase complex      120597671 (PSMB9) Peptidases and inhibitors [BR:pgig01002]  Threonine peptidases   Family T1: proteasome family    120597671 (PSMB9) Proteasome [BR:pgig03051]  Eukaryotic proteasome   Core particles (20S proteasome)    beta type subunits     120597671 (PSMB9) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Proteasome Motif Other DBs NCBI-GeneID:  120597671 NCBI-ProteinID:  XP_039712250 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MAKGRGYRVSAAGCPRSETSAPGSEERGAVMLRTGAPTGDFPRAGEVHTGTTIMAVEFDG GVVVGSDSRVSAGEAVVNRVFDKLSPLHHRIYCALSGSAADAQAVADMAAYQLELHGYEA LGSSHHTC NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggcgaaggggcggggctatagggtgagcgcagctggctgtcccaggtcggaaactagt gccccaggcagcgaggagcgcggcgcggtgatgcttcggacgggagcaccaactggggac tttccccgagccggagaagtccacactgggacaaccatcatggcagtagagtttgacggg ggtgttgtggtgggttctgattcccgggtgtctgcaggagaagcagtggtgaatcgggta tttgacaagctgtcccctctacaccatcgcatctactgtgccctctctggttcagctgct gatgcccaggccgtggcagacatggctgcctaccaactggagctccatgggtatgaagct ctggggtcttcacaccacacctgctag

DBGET integrated database retrieval system