Pteropus vampyrus (Indian flying fox): 120598918 Help Entry 120598918         CDS       T07511                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04060   Cytokine-cytokine receptor interaction pgig04620   Toll-like receptor signaling pathway pgig04622   RIG-I-like receptor signaling pathway pgig04625   C-type lectin receptor signaling pathway pgig04630   JAK-STAT signaling pathway pgig04658   Th1 and Th2 cell differentiation pgig04936   Alcoholic liver disease pgig04940   Type I diabetes mellitus pgig05133   Pertussis pgig05134   Legionellosis pgig05140   Leishmaniasis pgig05142   Chagas disease pgig05143   African trypanosomiasis pgig05144   Malaria pgig05145   Toxoplasmosis pgig05146   Amoebiasis pgig05152   Tuberculosis pgig05162   Measles pgig05164   Influenza A pgig05168   Herpes simplex virus 1 infection pgig05171   Coronavirus disease - COVID-19 pgig05200   Pathways in cancer pgig05321   Inflammatory bowel disease pgig05330   Allograft rejection pgig05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     120598918 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120598918 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120598918 (IL12A)    04622 RIG-I-like receptor signaling pathway     120598918 (IL12A)    04625 C-type lectin receptor signaling pathway     120598918 (IL12A)    04658 Th1 and Th2 cell differentiation     120598918 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120598918 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     120598918 (IL12A)    05164 Influenza A     120598918 (IL12A)    05162 Measles     120598918 (IL12A)    05168 Herpes simplex virus 1 infection     120598918 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     120598918 (IL12A)    05134 Legionellosis     120598918 (IL12A)    05152 Tuberculosis     120598918 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     120598918 (IL12A)    05144 Malaria     120598918 (IL12A)    05145 Toxoplasmosis     120598918 (IL12A)    05140 Leishmaniasis     120598918 (IL12A)    05142 Chagas disease     120598918 (IL12A)    05143 African trypanosomiasis     120598918 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     120598918 (IL12A)    05330 Allograft rejection     120598918 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120598918 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     120598918 (IL12A)    04936 Alcoholic liver disease     120598918 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pgig04052]     120598918 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:pgig00536]     120598918 (IL12A) Cytokines and neuropeptides [BR:pgig04052]  Cytokines   Interleukins    120598918 (IL12A) Glycosaminoglycan binding proteins [BR:pgig00536]  Heparan sulfate / Heparin   Cytokines    120598918 (IL12A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12 Motif Other DBs NCBI-GeneID:  120598918 NCBI-ProteinID:  XP_039713988 LinkDB All DBs Position Unknown AA seq 222 aa AA seqDB search MNPPHGLLLVATLVLLNHLDHFSLARNLPTATPGPGMFKCLNHSQNLLRAVSSALQKARQ TLEFYSCTSEEIDHEDITKDKTSTIEACLPLELTTNESCLVSREISFITNGNCLASGKAS YMMTLCLSSIYEDLKMYQVEFKAMNAKLLMDPKRQIILDQNMLAAIDELMQALNFNSEIV PQKPFFEEPDLYKTKIKLCILLHALRIRAVTIDRVMSYLNSS NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atgaacccaccgcacggactcctccttgtggccactctggtcctcctaaaccacctggac cacttcagtttggccaggaacctccccacagccacaccaggcccaggaatgttcaagtgc ctcaaccactcccaaaacctgctgagggccgtcagcagcgcacttcagaaggccagacaa actctagaattttactcctgcacttctgaagagatcgatcatgaagatattacaaaagat aaaaccagcaccatagaggcctgtttaccactggaattaaccacgaatgaaagttgcctg gtttccagagagatctctttcataactaatgggaattgcctggcctctgggaaggcttct tatatgatgaccctctgccttagtagtatctatgaggacttgaagatgtaccaggtggag ttcaaggccatgaatgcaaagcttttgatggatcctaagaggcagatcattctggatcaa aatatgctggcagctattgatgagctaatgcaggccctgaatttcaacagtgagattgtg ccacaaaaacccttctttgaagaaccagatttatataagactaaaatcaagctctgcatc cttcttcatgctctcagaattcgtgcagtgactattgatagggtgatgagctatctgaat tcttcctaa

DBGET integrated database retrieval system