Pteropus vampyrus (Indian flying fox): 120601454 Help Entry 120601454         CDS       T07511                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04072   Phospholipase D signaling pathway pgig04140   Autophagy - animal pgig04150   mTOR signaling pathway pgig04151   PI3K-Akt signaling pathway pgig04152   AMPK signaling pathway pgig04211   Longevity regulating pathway pgig04218   Cellular senescence pgig04714   Thermogenesis pgig04910   Insulin signaling pathway pgig04919   Thyroid hormone signaling pathway pgig05163   Human cytomegalovirus infection pgig05165   Human papillomavirus infection pgig05168   Herpes simplex virus 1 infection pgig05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     120601454 (RHEB)    04151 PI3K-Akt signaling pathway     120601454 (RHEB)    04152 AMPK signaling pathway     120601454 (RHEB)    04150 mTOR signaling pathway     120601454 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120601454 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     120601454 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     120601454 (RHEB)    04919 Thyroid hormone signaling pathway     120601454 (RHEB)   09149 Aging    04211 Longevity regulating pathway     120601454 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     120601454 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     120601454 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     120601454 (RHEB)    05163 Human cytomegalovirus infection     120601454 (RHEB)    05165 Human papillomavirus infection     120601454 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pgig04031]     120601454 (RHEB) GTP-binding proteins [BR:pgig04031]  Small (monomeric) G-proteins   Ras Family    Rheb     120601454 (RHEB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase RhoGAP_pG2 SRPRB AAA_14 DUF1842 Motif Other DBs NCBI-GeneID:  120601454 NCBI-ProteinID:  XP_039717076 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcattgacgattcagtttgtcgaaggccaatttgtggactcctacgatccaaccatagag aacactttcacaaaattgatcacagtaaatggacaagaatatcatcttcaacttgtagac acagctgggcaagatgaatattccatctttcctcagacatactccatagatattaatggt tacattctcgtgtattctgttacatcaatcaaaagtttcgaagtgattaaagttatccac ggcaagttgttggacatggtgggaaaagtgcaaatacctattatgttggttggcaataag aaagacctacatatggaaagggtgatcagttatgaagaagggaaggcgttagcagaatct tggaatgcagcttttttggaatcttctgctaaagaaaatcagaccgctgttgatgttttt agaaggataattttggaggcagaaaaaattgatggggccgcttcacaaggaaagtcttcc tgctcagtgatgtaa

DBGET integrated database retrieval system