Pteropus vampyrus (Indian flying fox): 120603516 Help Entry 120603516         CDS       T07511                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig01521   EGFR tyrosine kinase inhibitor resistance pgig01524   Platinum drug resistance pgig04014   Ras signaling pathway pgig04064   NF-kappa B signaling pathway pgig04115   p53 signaling pathway pgig04137   Mitophagy - animal pgig04140   Autophagy - animal pgig04151   PI3K-Akt signaling pathway pgig04210   Apoptosis pgig04215   Apoptosis - multiple species pgig04621   NOD-like receptor signaling pathway pgig04630   JAK-STAT signaling pathway pgig05012   Parkinson disease pgig05014   Amyotrophic lateral sclerosis pgig05022   Pathways of neurodegeneration - multiple diseases pgig05145   Toxoplasmosis pgig05162   Measles pgig05166   Human T-cell leukemia virus 1 infection pgig05168   Herpes simplex virus 1 infection pgig05170   Human immunodeficiency virus 1 infection pgig05200   Pathways in cancer pgig05202   Transcriptional misregulation in cancer pgig05212   Pancreatic cancer pgig05220   Chronic myeloid leukemia pgig05222   Small cell lung cancer pgig05225   Hepatocellular carcinoma pgig05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     120603516 (BCL2L1)    04630 JAK-STAT signaling pathway     120603516 (BCL2L1)    04064 NF-kappa B signaling pathway     120603516 (BCL2L1)    04151 PI3K-Akt signaling pathway     120603516 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120603516 (BCL2L1)    04137 Mitophagy - animal     120603516 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     120603516 (BCL2L1)    04215 Apoptosis - multiple species     120603516 (BCL2L1)    04115 p53 signaling pathway     120603516 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120603516 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120603516 (BCL2L1)    05202 Transcriptional misregulation in cancer     120603516 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     120603516 (BCL2L1)    05225 Hepatocellular carcinoma     120603516 (BCL2L1)    05220 Chronic myeloid leukemia     120603516 (BCL2L1)    05222 Small cell lung cancer     120603516 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120603516 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     120603516 (BCL2L1)    05162 Measles     120603516 (BCL2L1)    05168 Herpes simplex virus 1 infection     120603516 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     120603516 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     120603516 (BCL2L1)    05014 Amyotrophic lateral sclerosis     120603516 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     120603516 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120603516 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     120603516 (BCL2L1)    01524 Platinum drug resistance     120603516 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pgig01009]     120603516 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pgig03036]     120603516 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pgig02000]     120603516 (BCL2L1) Protein phosphatases and associated proteins [BR:pgig01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      120603516 (BCL2L1) Chromosome and associated proteins [BR:pgig03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     120603516 (BCL2L1) Transporters [BR:pgig02000]  Other transporters   Pores ion channels [TC:1]    120603516 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  120603516 NCBI-ProteinID:  XP_039719953 UniProt:  A0A6P3RD88 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMEPPSAVNGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWLLTGVTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagttcagtgatgtggaagagaacagaactgaggccccagaagga actgaatcagagatggagccccccagtgccgtcaatggcaacccatcctggcacctggcg gacagccccgcagtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcagtgaaacaagcactgagggaagcaggtgatgagtttgaactgagg taccggcgggcattcagcgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gttttggtgagtcggattgcaacttggatggctacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacactttcgtggaactctacgggaacaatgcagcg gccgagagccggaagggtcaggagcgcttcaaccgctggcttctgacaggagtgactgtg gctggcgtggttctgctgggctcacttttcagtcggaaatga

DBGET integrated database retrieval system