Pteropus vampyrus (Indian flying fox): 120605312 Help Entry 120605312         CDS       T07511                                  Name (RefSeq) interferon alpha-4-like   KO K05414   interferon alpha Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04060   Cytokine-cytokine receptor interaction pgig04151   PI3K-Akt signaling pathway pgig04217   Necroptosis pgig04620   Toll-like receptor signaling pathway pgig04621   NOD-like receptor signaling pathway pgig04622   RIG-I-like receptor signaling pathway pgig04623   Cytosolic DNA-sensing pathway pgig04630   JAK-STAT signaling pathway pgig04650   Natural killer cell mediated cytotoxicity pgig04936   Alcoholic liver disease pgig05152   Tuberculosis pgig05160   Hepatitis C pgig05161   Hepatitis B pgig05162   Measles pgig05163   Human cytomegalovirus infection pgig05164   Influenza A pgig05165   Human papillomavirus infection pgig05167   Kaposi sarcoma-associated herpesvirus infection pgig05168   Herpes simplex virus 1 infection pgig05169   Epstein-Barr virus infection pgig05170   Human immunodeficiency virus 1 infection pgig05171   Coronavirus disease - COVID-19 pgig05200   Pathways in cancer pgig05320   Autoimmune thyroid disease pgig05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     120605312    04151 PI3K-Akt signaling pathway     120605312   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120605312  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120605312  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120605312    04621 NOD-like receptor signaling pathway     120605312    04622 RIG-I-like receptor signaling pathway     120605312    04623 Cytosolic DNA-sensing pathway     120605312    04650 Natural killer cell mediated cytotoxicity     120605312  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120605312   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     120605312    05161 Hepatitis B     120605312    05160 Hepatitis C     120605312    05171 Coronavirus disease - COVID-19     120605312    05164 Influenza A     120605312    05162 Measles     120605312    05168 Herpes simplex virus 1 infection     120605312    05163 Human cytomegalovirus infection     120605312    05167 Kaposi sarcoma-associated herpesvirus infection     120605312    05169 Epstein-Barr virus infection     120605312    05165 Human papillomavirus infection     120605312   09171 Infectious disease: bacterial    05152 Tuberculosis     120605312   09163 Immune disease    05320 Autoimmune thyroid disease     120605312   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120605312   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     120605312  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pgig04052]     120605312 Cytokines and neuropeptides [BR:pgig04052]  Cytokines   Interferons    120605312 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  120605312 NCBI-ProteinID:  XP_039722211 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MALPFSFLVAVGVLSCHSICSLGCDLPQTHSLVNRRALMLLGQMRRISPFSCLKDREDFG FLQGAFGGNQFQEAQAITVIHEVTWQTFLLFCTEASSTAWDETLLGRFCTGLYQQLNHLE ACQTQEVGTEETPLLDEDSTLAVRKYFQRITLYLQEKKHSPCAWEIVRAEIMRSYSLSTH LKERSRSKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggctctgcctttttccttcctggtggccgtgggggtgctcagctgccactccatctgc tctctgggctgtgacctgcctcagacccacagcctggtcaacaggagggcgttgatgctc ctgggacaaatgaggagaatctcccctttctcctgcctcaaggatagagaagattttgga ttcctccagggggcatttggtggcaaccagttccaggaggctcaagccatcactgtcatc catgaggtgacctggcagaccttcctcctgttctgcacagaggcttcgtccacagcttgg gatgagaccctgttaggcagattctgcactggactctatcagcagctgaaccacctggaa gcctgtcagacgcaggaggtggggacagaggagactcccctgctggatgaggactccacg ctggctgtgaggaaatacttccagagaatcaccctctatctgcaggagaagaaacacagc ccttgtgcctgggagattgtcagagcagagatcatgaggtcctactctttatcaacacac ttgaaggaaagatcaaggagtaaggattaa

DBGET integrated database retrieval system