Pteropus vampyrus (Indian flying fox): 120606191 Help Entry 120606191         CDS       T07511                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04613   Neutrophil extracellular trap formation pgig05034   Alcoholism pgig05203   Viral carcinogenesis pgig05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pgig00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120606191  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     120606191   09163 Immune disease    05322 Systemic lupus erythematosus     120606191   09165 Substance dependence    05034 Alcoholism     120606191  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pgig03036]     120606191 Chromosome and associated proteins [BR:pgig03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120606191 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  120606191 NCBI-ProteinID:  XP_039723302 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaaaggcgggaaggggctcggcaaagggggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcgcctggcgcgg cgcggcggcgtcaagcgcatctccgggctcatctacgaggagacccgcggggtgctcaag gtcttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcacgctctacggc ttcgggggctga

DBGET integrated database retrieval system