Pteropus vampyrus (Indian flying fox): 120606489 Help Entry 120606489         CDS       T07511                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04140   Autophagy - animal pgig04144   Endocytosis pgig04152   AMPK signaling pathway pgig04530   Tight junction pgig04972   Pancreatic secretion pgig05014   Amyotrophic lateral sclerosis pgig05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     120606489 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120606489 (RAB8A)    04140 Autophagy - animal     120606489 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     120606489 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     120606489 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     120606489 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     120606489 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pgig04131]     120606489 (RAB8A)    03036 Chromosome and associated proteins [BR:pgig03036]     120606489 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgig04147]     120606489 (RAB8A)    04031 GTP-binding proteins [BR:pgig04031]     120606489 (RAB8A) Membrane trafficking [BR:pgig04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     120606489 (RAB8A)  Autophagy   Other autophagy associated proteins     120606489 (RAB8A) Chromosome and associated proteins [BR:pgig03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     120606489 (RAB8A) Exosome [BR:pgig04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120606489 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    120606489 (RAB8A)   Exosomal proteins of colorectal cancer cells    120606489 (RAB8A) GTP-binding proteins [BR:pgig04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     120606489 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin AAA_7 DUF6974 Motif Other DBs NCBI-GeneID:  120606489 NCBI-ProteinID:  XP_039723636 LinkDB All DBs Position Unknown AA seq 236 aa AA seqDB search MGGGMGADGRGQQPVARRWLHFPSGRECNMAKTYDYLFKLLLIGDSGVGKTCVLFRFSED AFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDIT NEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETS AKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKKTSFFRCVLL NT seq 711 nt NT seq  +upstreamnt  +downstreamnt atgggaggcggaatgggcgctgatggacgggggcagcaaccagtggcgaggcgctggctg cacttcccgtcggggagagagtgtaatatggcgaagacctacgattacctgttcaagctg ctgctgatcggggactcgggggtggggaagacctgtgtcctgttccgcttctccgaggac gccttcaactccactttcatctccaccataggaattgactttaaaattaggactatagag cttgatggcaagagaattaaactacagatatgggacacagctggccaggaacggtttcgg acgatcacaacagcctactacaggggcgcgatgggcatcatgctggtctacgacatcacc aatgagaagtcctttgacaacatccggaactggattcggaacattgaggagcatgcttct gcagacgtcgaaaagatgatacttgggaacaagtgtgacgtgaacgacaagagacaagtg tccaaggaacggggagagaagctggccctggactatggaattaagttcatggagaccagc gcgaaagccaacatcaacgtggagaacgcatttttcactcttgccagagacatcaaagca aaaatggacaaaaaattggaaggcaatagcccccaagggagcaaccagggagtcaaaatc acaccagaccagcagaagaagaccagctttttccgatgtgttcttctgtga

DBGET integrated database retrieval system