Pteropus giganteus (Indian flying fox): 120608993 Help Entry 120608993         CDS       T07511                                  Name (RefSeq) calmodulin-alpha-like isoform X1   KO K02183   calmodulin Organism pgig  Pteropus giganteus (Indian flying fox) Pathway pgig04014   Ras signaling pathway pgig04015   Rap1 signaling pathway pgig04020   Calcium signaling pathway pgig04022   cGMP-PKG signaling pathway pgig04024   cAMP signaling pathway pgig04070   Phosphatidylinositol signaling system pgig04114   Oocyte meiosis pgig04218   Cellular senescence pgig04261   Adrenergic signaling in cardiomyocytes pgig04270   Vascular smooth muscle contraction pgig04371   Apelin signaling pathway pgig04625   C-type lectin receptor signaling pathway pgig04713   Circadian entrainment pgig04720   Long-term potentiation pgig04722   Neurotrophin signaling pathway pgig04728   Dopaminergic synapse pgig04740   Olfactory transduction pgig04744   Phototransduction pgig04750   Inflammatory mediator regulation of TRP channels pgig04910   Insulin signaling pathway pgig04912   GnRH signaling pathway pgig04915   Estrogen signaling pathway pgig04916   Melanogenesis pgig04921   Oxytocin signaling pathway pgig04922   Glucagon signaling pathway pgig04924   Renin secretion pgig04925   Aldosterone synthesis and secretion pgig04970   Salivary secretion pgig04971   Gastric acid secretion pgig05010   Alzheimer disease pgig05012   Parkinson disease pgig05022   Pathways of neurodegeneration - multiple diseases pgig05031   Amphetamine addiction pgig05034   Alcoholism pgig05133   Pertussis pgig05152   Tuberculosis pgig05163   Human cytomegalovirus infection pgig05167   Kaposi sarcoma-associated herpesvirus infection pgig05170   Human immunodeficiency virus 1 infection pgig05200   Pathways in cancer pgig05214   Glioma pgig05417   Lipid and atherosclerosis pgig05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     120608993    04015 Rap1 signaling pathway     120608993    04371 Apelin signaling pathway     120608993    04020 Calcium signaling pathway     120608993    04070 Phosphatidylinositol signaling system     120608993    04024 cAMP signaling pathway     120608993    04022 cGMP-PKG signaling pathway     120608993  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     120608993    04218 Cellular senescence     120608993  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120608993   09152 Endocrine system    04910 Insulin signaling pathway     120608993    04922 Glucagon signaling pathway     120608993    04912 GnRH signaling pathway     120608993    04915 Estrogen signaling pathway     120608993    04921 Oxytocin signaling pathway     120608993    04916 Melanogenesis     120608993    04924 Renin secretion     120608993    04925 Aldosterone synthesis and secretion     120608993   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     120608993    04270 Vascular smooth muscle contraction     120608993   09154 Digestive system    04970 Salivary secretion     120608993    04971 Gastric acid secretion     120608993   09156 Nervous system    04728 Dopaminergic synapse     120608993    04720 Long-term potentiation     120608993    04722 Neurotrophin signaling pathway     120608993   09157 Sensory system    04744 Phototransduction     120608993    04740 Olfactory transduction     120608993    04750 Inflammatory mediator regulation of TRP channels     120608993   09159 Environmental adaptation    04713 Circadian entrainment     120608993  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120608993   09162 Cancer: specific types    05214 Glioma     120608993   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     120608993    05163 Human cytomegalovirus infection     120608993    05167 Kaposi sarcoma-associated herpesvirus infection     120608993   09171 Infectious disease: bacterial    05133 Pertussis     120608993    05152 Tuberculosis     120608993   09164 Neurodegenerative disease    05010 Alzheimer disease     120608993    05012 Parkinson disease     120608993    05022 Pathways of neurodegeneration - multiple diseases     120608993   09165 Substance dependence    05031 Amphetamine addiction     120608993    05034 Alcoholism     120608993   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120608993    05418 Fluid shear stress and atherosclerosis     120608993  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pgig01009]     120608993   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pgig04131]     120608993    03036 Chromosome and associated proteins [BR:pgig03036]     120608993   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgig04147]     120608993 Protein phosphatases and associated proteins [BR:pgig01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      120608993 Membrane trafficking [BR:pgig04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     120608993 Chromosome and associated proteins [BR:pgig03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      120608993 Exosome [BR:pgig04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    120608993 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_5 EF-hand_6 EF-hand_9 AIF-1 EF-hand_4 SPARC_Ca_bdg UPF0154 Dockerin_1 TerB DIMCO_N DUF5580_M SCO1-SenC DUF6772 Motif Other DBs NCBI-GeneID:  120608993 NCBI-ProteinID:  XP_039726927 LinkDB All DBs Position Unknown AA seq 236 aa AA seqDB search MFPAASQGGPCPSNSCISCLQLASPSPEEDFARGHGVGGEPASSLCSDCRKGGVPTPWQG RHRSSAPTQSQPRPSPDRSTLSWPAASAMAEKLSKEQVADLKAVFTRFDTDGDGNINLQE LGDAMRALGQDPTEAELKEIITRVDTDGDGAISFQEFLAEMAKRMKSGISEQDMREVFRA FDLDGDGHISVDELKQAMAQVGEKLSQEDVEAMIREADVDQDGQVDYEEFTRILTR NT seq 711 nt NT seq  +upstreamnt  +downstreamnt atgttccctgcggcctcccagggcgggccctgcccctccaattcctgcatttcctgtctg cagctggcctctccctccccggaggaggattttgcccgaggacacggtgtgggtggggag ccggcctcctccctgtgctccgattgcagaaaaggaggggtccccaccccatggcaaggc cgccaccggagctctgcccccactcagtcgcagcctcgtcccagccctgaccggagcact ctgagctggccggcagcaagcgccatggccgagaagctgtcgaaagagcaggtggcggac ttgaaggcggtgttcaccaggttcgacacggacggtgacggcaacatcaacctgcaggag ctgggcgacgccatgcgggccctgggccaggacccgacggaggccgagctgaaggagatc atcacccgggtggacacggacggcgacggcgccatcagcttccaggagttcctggcggag atggccaagaggatgaagtccggcatcagcgagcaggacatgcgggaggtcttccgcgcc tttgacctggacggcgacggccacatcagcgtagacgagctcaagcaggccatggcccag gtgggcgagaagctgtcccaagaggacgtggaggccatgatccgagaggctgacgtggac caggacggacaggtggactatgaggagttcacacgcatcctcacccgctag

DBGET integrated database retrieval system