Pteropus vampyrus (Indian flying fox): 120610305 Help Entry 120610305         CDS       T07511                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha   KO K04383   interleukin 1 alpha Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04010   MAPK signaling pathway pgig04060   Cytokine-cytokine receptor interaction pgig04217   Necroptosis pgig04218   Cellular senescence pgig04380   Osteoclast differentiation pgig04640   Hematopoietic cell lineage pgig04932   Non-alcoholic fatty liver disease pgig04933   AGE-RAGE signaling pathway in diabetic complications pgig04940   Type I diabetes mellitus pgig05010   Alzheimer disease pgig05020   Prion disease pgig05022   Pathways of neurodegeneration - multiple diseases pgig05133   Pertussis pgig05140   Leishmaniasis pgig05152   Tuberculosis pgig05162   Measles pgig05164   Influenza A pgig05321   Inflammatory bowel disease pgig05323   Rheumatoid arthritis pgig05332   Graft-versus-host disease pgig05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120610305 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120610305 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120610305 (IL1A)    04218 Cellular senescence     120610305 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     120610305 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     120610305 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     120610305 (IL1A)    05162 Measles     120610305 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     120610305 (IL1A)    05152 Tuberculosis     120610305 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     120610305 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     120610305 (IL1A)    05321 Inflammatory bowel disease     120610305 (IL1A)    05332 Graft-versus-host disease     120610305 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     120610305 (IL1A)    05020 Prion disease     120610305 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     120610305 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     120610305 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     120610305 (IL1A)    04932 Non-alcoholic fatty liver disease     120610305 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     120610305 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pgig04052]     120610305 (IL1A) Cytokines and neuropeptides [BR:pgig04052]  Cytokines   Interleukins    120610305 (IL1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1_propep IL1 Motif Other DBs NCBI-GeneID:  120610305 NCBI-ProteinID:  XP_039728563 LinkDB All DBs Position Unknown AA seq 270 aa AA seqDB search MAKVPDVFEDLKNCYSENEEYSSDADQLSLNQKSFYDTSYDTLHEDHGGKLRSLGTSEAS KMSQLTFKESVVVLAANGKVLKKRRLSFDQFITDEDLEAIANDTKEEPIQPHLAPMSFQS SMKYSFMKVIKQQCILSDTLSQSLIRDTSGQYLMAAALNDLNQAVKFDMGAYITDEDSPF PVTLRISKTRLFLSAQNEDEPVLLKEMPETPKAIKDETNLLFLWESHGTKNYFKSVAQPK LFIATKQEHLVHMARGQPSITDFQILENGP NT seq 813 nt NT seq  +upstreamnt  +downstreamnt atggccaaggtccccgacgtctttgaagacctgaagaattgttacagtgagaatgaagaa tatagttctgatgctgaccaactctctctgaatcagaaatccttctatgacacaagctac gacacactgcatgaagaccatggaggtaaacttaggtctctgggtacctcagaggcctca aagatgtctcagctcaccttcaaggagagtgtggtggtgctggcagccaacgggaaggtc ctgaagaagaggcgactgagtttcgatcagttcatcaccgatgaagacctggaagccatt gccaacgatacaaaagaagaacccatccagccccatttggcacctatgagcttccagagc agcatgaagtacagcttcatgaaggtcatcaaacagcagtgcatcctgagtgacacactc agtcagagtctcattcgagatacatcgggtcagtacctcatggcagctgcactaaatgac ctcaaccaagcagtgaaatttgacatgggtgcttacataacagatgaagattctccattt cctgtgactctaagaatctcaaaaacacgactctttttgagtgcccaaaacgaagatgag cctgtgctgctgaaggagatgcctgagacacccaaagccatcaaagatgagaccaatctc ctcttcctctgggaaagtcacggcacaaagaactacttcaagtcagtcgcccaaccaaag ctgttcattgccacaaaacaagaacacctggtgcatatggcgagggggcagccctccatc acggactttcagatactggaaaacgggccttga

DBGET integrated database retrieval system