Pteropus vampyrus (Indian flying fox): 120612158 Help Entry 120612158         CDS       T07511                                  Name (RefSeq) mitoregulin   KO K29035   mitoregulin Organism pgig  Pteropus vampyrus (Indian flying fox) Brite KEGG Orthology (KO) [BR:pgig00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:pgig03029]     120612158 Mitochondrial biogenesis [BR:pgig03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     120612158 SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom CheW_CheR_link Motif Other DBs NCBI-GeneID:  120612158 NCBI-ProteinID:  XP_039730584 LinkDB All DBs Position Unknown AA seq 56 aa AA seqDB search MADVSERKLQLSMLLAFASGVLVGWQANRLRRRYLDWRKRRLQDKLAVTQKKLDLA NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggcggatgtgtccgagaggaagctacagctgtcaatgctgttggccttcgcctcagga gtgctcgtgggttggcaggcaaaccggctgcggaggcgctacctggactggagaaagcgg agacttcaggacaaactggcggtgacgcagaaaaagctggacctggcttga

DBGET integrated database retrieval system