Pteropus vampyrus (Indian flying fox): 120616425 Help Entry 120616425         CDS       T07511                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04613   Neutrophil extracellular trap formation pgig05034   Alcoholism pgig05203   Viral carcinogenesis pgig05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pgig00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120616425  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     120616425   09163 Immune disease    05322 Systemic lupus erythematosus     120616425   09165 Substance dependence    05034 Alcoholism     120616425  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pgig03036]     120616425   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgig04147]     120616425 Chromosome and associated proteins [BR:pgig03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120616425 Exosome [BR:pgig04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120616425 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TAF Motif Other DBs NCBI-GeneID:  120616425 NCBI-ProteinID:  XP_039735737 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MPAPASEASEGLLGTQKPTEAPPKAPDQKTPRRPRRRCSDTFTTYFPRVLKNVHQGPSLS REAVSVMDSFVEDIFQRIAEEASRLVLSNQRATMTSRDIQTAVRLPLPGEMGKHALSEAT KAVLRSSLCLIRQQIKCRSSYKNPSVF NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgcctgcgcctgcctctgaggcttctgagggattgctgggcacgcagaagcccacggaa gcacccccgaaggcccctgaccagaagacgccaaggcgcccgcgccgccgctgctccgac actttcaccacctatttcccccgggttctgaagaacgttcaccagggcccgagcctgtcg cgggaggccgtgagcgtcatggattcgttcgtggaggacatcttccagcgcatcgccgaa gaggcctcgcgcctggtcctctccaaccagcgcgccaccatgacctccagagacatccag acggccgtgaggctgcccctgcccggggagatgggcaagcacgccttgtccgaggccacc aaggccgtcctccgaagttcattatgtctgatacgacaacagataaagtgcagaagcagt tacaagaatccatccgtcttctga

DBGET integrated database retrieval system